OR1L4/1L6 Antibody - #DF2844
Product: | OR1L4/1L6 Antibody |
Catalog: | DF2844 |
Description: | Rabbit polyclonal antibody to OR1L4/1L6 |
Application: | WB IHC |
Reactivity: | Human, Mouse |
Mol.Wt.: | 35 kDa/40 kDa; 35kD,40kD(Calculated). |
Uniprot: | Q8NGR5 | Q8NGR2 |
RRID: | AB_2840050 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF2844, RRID:AB_2840050.
Fold/Unfold
Olfactory receptor 1L4; Olfactory receptor 1L5; Olfactory receptor 9-E; Olfactory receptor family 1 subfamily L member 4; Olfactory receptor family 1 subfamily L member 5; Olfactory receptor OR9-29; OR1L4; OR1L5; OR9-29; OR9-E; OST046; HG16; Olfactory receptor 1L6; Olfactory receptor 1L7; Olfactory receptor OR9-30; OR1L6; OR1L6_HUMAN; OR1L7; OR9-30;
Immunogens
- Q8NGR5 OR1L4_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
METKNYSSSTSGFILLGLSSNPKLQKPLFAIFLIMYLLTAVGNVLIILAIYSDPRLHTPMYFFLSNLSFMDICFTTVIVPKMLVNFLSETKIISYVGCLIQMYFFMAFGNTDSYLLASMAIDRLVAICNPLHYDVVMKPWHCLLMLLGSCSISHLHSLFRVLLMSRLSFCASHIIKHFFCDTQPVLKLSCSDTSSSQMVVMTETLAVIVTPFLCTIFSYLQIIVTVLRIPSAAGKWKAFSTCGSHLTVVVLFYGSVIYVYFRPLSMYSVMKGRVATVMYTVVTPMLNPFIYSLRNKDMKRGLKKLRHRIYS
- Q8NGR2 OR1L6_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MSYFYRLKLMKEAVLVKLPFTSLPLLLQTLSRKSRDMEIKNYSSSTSGFILLGLSSNPQLQKPLFAIFLIMYLLAAVGNVLIIPAIYSDPRLHTPMYFFLSNLSFMDICFTTVIVPKMLVNFLSETKVISYVGCLAQMYFFMAFGNTDSYLLASMAIDRLVAICNPLHYDVVMKPRHCLLMLLGSCSISHLHSLFRVLLMSRLSFCASHIIKHFFCDTQPVLKLSCSDTSSSQMVVMTETLAVIVTPFLCIIFSYLRIMVTVLRIPSAAGKWKAFSTCGSHLTAVALFYGSIIYVYFRPLSMYSVVRDRVATVMYTVVTPMLNPFIYSLRNKDMKRGLKKLQDRIYR
PTMs - Q8NGR5/Q8NGR2 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
Y3 | Phosphorylation | Uniprot | |
Y5 | Phosphorylation | Uniprot | |
T319 | Phosphorylation | Uniprot | |
Y327 | Phosphorylation | Uniprot | |
S328 | Phosphorylation | Uniprot |
Site | PTM Type | Enzyme | Source |
---|---|---|---|
T283 | Phosphorylation | Uniprot | |
Y291 | Phosphorylation | Uniprot | |
S292 | Phosphorylation | Uniprot |
Research Backgrounds
Odorant receptor.
Cell membrane>Multi-pass membrane protein.
Belongs to the G-protein coupled receptor 1 family.
Odorant receptor.
Cell membrane>Multi-pass membrane protein.
Belongs to the G-protein coupled receptor 1 family.
Research Fields
· Organismal Systems > Sensory system > Olfactory transduction.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.