DUSP26 Antibody - #DF2458
Product: | DUSP26 Antibody |
Catalog: | DF2458 |
Description: | Rabbit polyclonal antibody to DUSP26 |
Application: | WB |
Reactivity: | Human, Mouse, Rat |
Prediction: | Pig, Bovine, Horse, Sheep, Rabbit, Dog |
Mol.Wt.: | 24 kDa; 24kD(Calculated). |
Uniprot: | Q9BV47 |
RRID: | AB_2839664 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF2458, RRID:AB_2839664.
Fold/Unfold
DSP-4; Dual specificity phosphatase 26 (putative); Dual specificity phosphatase 26; Dual specificity phosphatase SKRP3; Dual specificity protein phosphatase 26; DUS26_HUMAN; DUSP24; DUSP26; Hypothetical protein FLJ31142; LDP 4; LDP-4; Low molecular mass dual specificity phosphatase 4; Low-molecular-mass dual-specificity phosphatase 4; MAP kinase phosphatase 8; MGC1136; MGC2627; Mitogen activated protein kinase phosphatase 8; Mitogen-activated protein kinase phosphatase 8; MKP-8; MKP8; NATA1; NATA1 protein; Novel amplified gene in thyroid anaplastic cancer; SKRP3;
Immunogens
Brain. In the brain it is expressed ubiquitously except in the hippocampus. Expressed in embryonal cancers (retinoblastoma, neuroepithilioma and neuroblastoma) and in anaplatic thyroid cancer.
- Q9BV47 DUS26_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MCPGNWLWASMTFMARFSRSSSRSPVRTRGTLEEMPTVQHPFLNVFELERLLYTGKTACNHADEVWPGLYLGDQDMANNRRELRRLGITHVLNASHSRWRGTPEAYEGLGIRYLGVEAHDSPAFDMSIHFQTAADFIHRALSQPGGKILVHCAVGVSRSATLVLAYLMLYHHLTLVEAIKKVKDHRGIIPNRGFLRQLLALDRRLRQGLEA
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q9BV47 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
S18 | Phosphorylation | Uniprot | |
S20 | Phosphorylation | Uniprot | |
S22 | Phosphorylation | Uniprot |
Research Backgrounds
Inactivates MAPK1 and MAPK3 which leads to dephosphorylation of heat shock factor protein 4 and a reduction in its DNA-binding activity. Inhibits MAP kinase p38 by dephosphorylating it and inhibits p38-mediated apoptosis in anaplastic thyroid cancer cells. Can also induce activation of MAP kinase p38 and c-Jun N-terminal kinase (JNK).
Cytoplasm. Nucleus. Golgi apparatus.
Brain. In the brain it is expressed ubiquitously except in the hippocampus. Expressed in embryonal cancers (retinoblastoma, neuroepithilioma and neuroblastoma) and in anaplatic thyroid cancer.
Interacts with HSF4.
Belongs to the protein-tyrosine phosphatase family. Non-receptor class dual specificity subfamily.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.