CXCR6 Antibody - #DF2328
Product: | CXCR6 Antibody |
Catalog: | DF2328 |
Description: | Rabbit polyclonal antibody to CXCR6 |
Application: | WB IHC |
Reactivity: | Human, Mouse, Rat |
Prediction: | Rabbit, Dog |
Mol.Wt.: | 44 kDa; 39kD(Calculated). |
Uniprot: | O00574 |
RRID: | AB_2839552 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF2328, RRID:AB_2839552.
Fold/Unfold
C X C chemokine receptor type 6; C-X-C chemokine receptor type 6; CD 186; CD186; CD186 antigen; CDw186; Chemokine (C X C motif) receptor 6; Chemokine C X C motif receptor 6; Chemokine CXC motif receptor 6; Chemokine receptor 6; CXC chemokine receptor type 6; CXC R6; CXC-R6; CXCR 6; CXCR-6; CXCR6; CXCR6_HUMAN; G protein coupled receptor; G protein coupled receptor bonzo; G protein coupled receptor STRL 33; G protein coupled receptor STRL33; G protein coupled receptor TYMSTR; G-protein coupled receptor bonzo; G-protein coupled receptor STRL33; STRL 33; STRL33; TYMSTR;
Immunogens
- O00574 CXCR6_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MAEHDYHEDYGFSSFNDSSQEEHQDFLQFSKVFLPCMYLVVFVCGLVGNSLVLVISIFYHKLQSLTDVFLVNLPLADLVFVCTLPFWAYAGIHEWVFGQVMCKSLLGIYTINFYTSMLILTCITVDRFIVVVKATKAYNQQAKRMTWGKVTSLLIWVISLLVSLPQIIYGNVFNLDKLICGYHDEAISTVVLATQMTLGFFLPLLTMIVCYSVIIKTLLHAGGFQKHRSLKIIFLVMAVFLLTQMPFNLMKFIRSTHWEYYAMTSFHYTIMVTEAIAYLRACLNPVLYAFVSLKFRKNFWKLVKDIGCLPYLGVSHQWKSSEDNSKTFSASHNVEATSMFQL
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - O00574 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
Y182 | Phosphorylation | Uniprot |
Research Backgrounds
Receptor for the C-X-C chemokine CXCL16. Used as a coreceptor by SIVs and by strains of HIV-2 and m-tropic HIV-1.
Cell membrane>Multi-pass membrane protein.
Expressed in lymphoid tissues and activated T cells.
Belongs to the G-protein coupled receptor 1 family.
Research Fields
· Environmental Information Processing > Signaling molecules and interaction > Cytokine-cytokine receptor interaction. (View pathway)
· Organismal Systems > Immune system > Chemokine signaling pathway. (View pathway)
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.