Product: CD41 Antibody
Catalog: DF7456
Description: Rabbit polyclonal antibody to CD41
Application: WB IHC
Reactivity: Human, Mouse, Rat
Prediction: Zebrafish, Bovine, Horse, Rabbit, Dog
Mol.Wt.: 113kDa; 113kD(Calculated).
Uniprot: P08514
RRID: AB_2839393

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:500-1:2000, IHC 1:50-1:200
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat
Prediction:
Zebrafish(92%), Bovine(92%), Horse(100%), Rabbit(92%), Dog(92%)
Clonality:
Polyclonal
Specificity:
CD41 Antibody detects endogenous levels of total CD41.
RRID:
AB_2839393
Cite Format: Affinity Biosciences Cat# DF7456, RRID:AB_2839393.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

antigen CD41; BDPLT16; BDPLT2; CD41; CD41B; form 2; GP2B; GPalpha IIb; GPIIb; GT; GTA; HPA3; Integrin alpha 2b; Integrin alpha IIb; Integrin alpha-IIb light chain; Integrin, alpha 2b (platelet glycoprotein IIb of IIb/IIIa complex, antigen CD41); ITA2B_HUMAN; Itga2b; ITGAB; platelet fibrinogen receptor, alpha subunit; platelet glycoprotein IIb of IIb/IIIa complex; Platelet membrane glycoprotein IIb; platelet specific antigen BAK; PPP1R93;

Immunogens

Immunogen:
Uniprot:
Gene(ID):
Expression:
P08514 ITA2B_HUMAN:

Isoform 1 and isoform 2 are expressed in platelets and megakaryocytes, but not in reticulocytes. Not detected in Jurkat, nor in U937 cell lines (PubMed:2351656). Isoform 3 is expressed in prostate adenocarcinoma, as well as in several erythroleukemia, prostate adenocarcinoma and melanoma cell lines, including PC-3, DU-145, HEL, WM983A, WM983B and WM35. Not detected in platelets, nor in normal prostate (at protein level) (PubMed:9809974).

Description:
ITGA2B encodes integrin alpha chain 2b. Integrins are heterodimeric integral membrane proteins composed of an alpha chain and a beta chain. Alpha chain 2b undergoes post-translational cleavage to yield disulfide-linked light and heavy chains that join with beta 3 to form a fibronectin receptor expressed in platelets that plays a crucial role in coagulation. Mutations that interfere with this role result in thrombasthenia. In addition to adhesion, integrins are known to participate in cell-surface mediated signalling.
Sequence:
MARALCPLQALWLLEWVLLLLGPCAAPPAWALNLDPVQLTFYAGPNGSQFGFSLDFHKDSHGRVAIVVGAPRTLGPSQEETGGVFLCPWRAEGGQCPSLLFDLRDETRNVGSQTLQTFKARQGLGASVVSWSDVIVACAPWQHWNVLEKTEEAEKTPVGSCFLAQPESGRRAEYSPCRGNTLSRIYVENDFSWDKRYCEAGFSSVVTQAGELVLGAPGGYYFLGLLAQAPVADIFSSYRPGILLWHVSSQSLSFDSSNPEYFDGYWGYSVAVGEFDGDLNTTEYVVGAPTWSWTLGAVEILDSYYQRLHRLRGEQMASYFGHSVAVTDVNGDGRHDLLVGAPLYMESRADRKLAEVGRVYLFLQPRGPHALGAPSLLLTGTQLYGRFGSAIAPLGDLDRDGYNDIAVAAPYGGPSGRGQVLVFLGQSEGLRSRPSQVLDSPFPTGSAFGFSLRGAVDIDDNGYPDLIVGAYGANQVAVYRAQPVVKASVQLLVQDSLNPAVKSCVLPQTKTPVSCFNIQMCVGATGHNIPQKLSLNAELQLDRQKPRQGRRVLLLGSQQAGTTLNLDLGGKHSPICHTTMAFLRDEADFRDKLSPIVLSLNVSLPPTEAGMAPAVVLHGDTHVQEQTRIVLDCGEDDVCVPQLQLTASVTGSPLLVGADNVLELQMDAANEGEGAYEAELAVHLPQGAHYMRALSNVEGFERLICNQKKENETRVVLCELGNPMKKNAQIGIAMLVSVGNLEEAGESVSFQLQIRSKNSQNPNSKIVLLDVPVRAEAQVELRGNSFPASLVVAAEEGEREQNSLDSWGPKVEHTYELHNNGPGTVNGLHLSIHLPGQSQPSDLLYILDIQPQGGLQCFPQPPVNPLKVDWGLPIPSPSPIHPAHHKRDRRQIFLPEPEQPSRLQDPVLVSCDSAPCTVVQCDLQEMARGQRAMVTVLAFLWLPSLYQRPLDQFVLQSHAWFNVSSLPYAVPPLSLPRGEAQVWTQLLRALEERAIPIWWVLVGVLGGLLLLTILVLAMWKVGFFKRNRPPLEEDDEEGE

Predictions

Predictions:

Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.

Species
Results
Score
Horse
100
Bovine
92
Dog
92
Zebrafish
92
Rabbit
92
Pig
0
Sheep
0
Xenopus
0
Chicken
0
Model Confidence:
High(score>80) Medium(80>score>50) Low(score<50) No confidence

PTMs - P08514 As Substrate

Site PTM Type Enzyme
N46 N-Glycosylation
S60 Phosphorylation
T73 Phosphorylation
Y197 Phosphorylation
N280 N-Glycosylation
Y319 Phosphorylation
Y344 Phosphorylation
Y360 Phosphorylation
Y384 Phosphorylation
Y479 Phosphorylation
N601 N-Glycosylation
N711 N-Glycosylation
S878 O-Glycosylation

Research Backgrounds

Function:

Integrin alpha-IIb/beta-3 is a receptor for fibronectin, fibrinogen, plasminogen, prothrombin, thrombospondin and vitronectin. It recognizes the sequence R-G-D in a wide array of ligands. It recognizes the sequence H-H-L-G-G-G-A-K-Q-A-G-D-V in fibrinogen gamma chain. Following activation integrin alpha-IIb/beta-3 brings about platelet/platelet interaction through binding of soluble fibrinogen. This step leads to rapid platelet aggregation which physically plugs ruptured endothelial cell surface.

Subcellular Location:

Membrane>Single-pass type I membrane protein.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Isoform 1 and isoform 2 are expressed in platelets and megakaryocytes, but not in reticulocytes. Not detected in Jurkat, nor in U937 cell lines. Isoform 3 is expressed in prostate adenocarcinoma, as well as in several erythroleukemia, prostate adenocarcinoma and melanoma cell lines, including PC-3, DU-145, HEL, WM983A, WM983B and WM35. Not detected in platelets, nor in normal prostate (at protein level).

Subunit Structure:

Heterodimer of an alpha and a beta subunit. The alpha subunit is composed of a heavy and a light chain linked by a disulfide bond. Alpha-IIb associates with beta-3. Directly interacts with RNF181. Interacts (via C-terminus cytoplasmic tail region) with CIB1; the interaction is direct and calcium-dependent. Interacts (via C-terminus cytoplasmic tail region) with CIB2, CIB3 and CIB4; the interactions are stabilized/increased in a calcium and magnesium-dependent manner.

Family&Domains:

Belongs to the integrin alpha chain family.

Research Fields

· Cellular Processes > Cellular community - eukaryotes > Focal adhesion.   (View pathway)

· Cellular Processes > Cell motility > Regulation of actin cytoskeleton.   (View pathway)

· Environmental Information Processing > Signal transduction > Rap1 signaling pathway.   (View pathway)

· Environmental Information Processing > Signal transduction > PI3K-Akt signaling pathway.   (View pathway)

· Environmental Information Processing > Signaling molecules and interaction > ECM-receptor interaction.   (View pathway)

· Human Diseases > Infectious diseases: Viral > Human papillomavirus infection.

· Human Diseases > Cancers: Overview > Pathways in cancer.   (View pathway)

· Human Diseases > Cancers: Specific types > Small cell lung cancer.   (View pathway)

· Human Diseases > Cardiovascular diseases > Hypertrophic cardiomyopathy (HCM).

· Human Diseases > Cardiovascular diseases > Arrhythmogenic right ventricular cardiomyopathy (ARVC).

· Human Diseases > Cardiovascular diseases > Dilated cardiomyopathy (DCM).

· Organismal Systems > Immune system > Platelet activation.   (View pathway)

· Organismal Systems > Immune system > Hematopoietic cell lineage.   (View pathway)

References

1). Artificial tumor microenvironment regulated by first hemorrhage for enhanced tumor targeting and then occlusion for synergistic bioactivation of hypoxia-sensitive platesomes. Acta Pharmaceutica Sinica B, 2022 (PubMed: 35530142) [IF=14.5]

2). Bioinspired Nanosponge for Salvaging Ischemic Stroke via Free Radical Scavenging and Self-Adapted Oxygen Regulating. NANO LETTERS, 2019 (PubMed: 31830790) [IF=10.8]

Application: WB    Species: mouse    Sample: erythrocyte

Figure S3. Component analysis of Hb, Mn, total protein in MNET. (A) Hb concentrtion of erythrocyte, NET and MNET (n=3). (B) ICP-MS analysis of Mn amounts in NE and MNE (n=3). (C) The analysis of SDS-PAGE protein electrophoresis of Marker , erythrocyte , NET and MNET. (D) Western blot analysis of Hb, CD41, CD235a and CD47 protein expression in different preparations.

3). Rescuing ischemic stroke by biomimetic nanovesicles through accelerated thrombolysis and sequential ischemia-reperfusion protection. Acta Biomaterialia, 2022 (PubMed: 34902617) [IF=9.7]

4). C1QA and COMP: plasma-based biomarkers for early diagnosis of pancreatic neuroendocrine tumors. Scientific reports, 2023 (PubMed: 38030709) [IF=4.6]

Application: WB    Species: Human    Sample:

Figure 5 Validation of potential protein targets. Western blot profiling and densitometric analysis of final selected proteins (A). Densitometric analysis of (B) C1QA (p = 0.001, 0.03, 0.0013); (C) COMP protein (p = 0.011, 0.019), (D) HSP90B1, (E) ITGA2B/CD41, (F) FN1, (G, H) Sandwich ELISA for C1QA binding analysis (I) ROC curve analysis for plasma C1QA levels in Grade I PanNET vs controls (J, K) Sandwich ELISA for COMP analysis (I) ROC curve analysis for plasma COMP levels in Grade I PanNET vs controls.

5). The active ingredients analysis of Herba Lysimachiae treating osteoarthritis based on the LC–MS/MS technology and public bioinformatics platforms. Journal of Separation Science, 2021 (PubMed: 34409742) [IF=3.1]

6). A new strategy for analyzing the active ingredients of herbal medicines based on the public bioinformatics platforms. Authorea Preprints, 2020

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.