DIABLO Antibody - #DF7017
Product: | DIABLO Antibody |
Catalog: | DF7017 |
Description: | Rabbit polyclonal antibody to DIABLO |
Application: | WB IHC IF/ICC |
Reactivity: | Human, Mouse, Rat |
Mol.Wt.: | 27kDa, 22 kDa; 27kD(Calculated). |
Uniprot: | Q9NR28 |
RRID: | AB_2838973 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF7017, RRID:AB_2838973.
Fold/Unfold
0610041G12Rik; DBLOH_HUMAN; DBOH; DFNA64; diablo; Diablo homolog (Drosophila); Diablo homolog; Diablo homolog mitochondrial; Diablo IAP binding mitochondrial protein; Diablo like protein; DIABLO S; Direct IAP binding protein with low pI; Direct IAP-binding protein with low pI; FLJ10537; FLJ25049; mitochondrial; Mitochondrial Smac protein; Second mitochondria derived activator of caspase; Second mitochondria-derived activator of caspase; SMAC 3; Smac; Smac protein; SMAC3;
Immunogens
Ubiquitously expressed with highest expression in testis. Expression is also high in heart, liver, kidney, spleen, prostate and ovary. Low in brain, lung, thymus and peripheral blood leukocytes. Isoform 3 is ubiquitously expressed.
- Q9NR28 DBLOH_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MAALKSWLSRSVTSFFRYRQCLCVPVVANFKKRCFSELIRPWHKTVTIGFGVTLCAVPIAQKSEPHSLSSEALMRRAVSLVTDSTSTFLSQTTYALIEAITEYTKAVYTLTSLYRQYTSLLGKMNSEEEDEVWQVIIGARAEMTSKHQEYLKLETTWMTAVGLSEMAAEAAYQTGADQASITARNHIQLVKLQVEEVHQLSRKAETKLAEAQIEELRQKTQEEGEERAESEQEAYLRED
PTMs - Q9NR28 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
S6 | Phosphorylation | P45983 (MAPK8) | Uniprot |
S9 | Phosphorylation | P45983 (MAPK8) | Uniprot |
S11 | Phosphorylation | Uniprot | |
T13 | Phosphorylation | Uniprot | |
K62 | Ubiquitination | Uniprot | |
S67 | Phosphorylation | P31749 (AKT1) | Uniprot |
K123 | Ubiquitination | Uniprot | |
S126 | Phosphorylation | Uniprot | |
K146 | Acetylation | Uniprot | |
K146 | Ubiquitination | Uniprot | |
K191 | Ubiquitination | Uniprot | |
K203 | Ubiquitination | Uniprot | |
K207 | Ubiquitination | Uniprot | |
K219 | Ubiquitination | Uniprot | |
T220 | Phosphorylation | Uniprot | |
S230 | Phosphorylation | Uniprot |
Research Backgrounds
Promotes apoptosis by activating caspases in the cytochrome c/Apaf-1/caspase-9 pathway. Acts by opposing the inhibitory activity of inhibitor of apoptosis proteins (IAP). Inhibits the activity of BIRC6/bruce by inhibiting its binding to caspases. Isoform 3 attenuates the stability and apoptosis-inhibiting activity of XIAP/BIRC4 by promoting XIAP/BIRC4 ubiquitination and degradation through the ubiquitin-proteasome pathway. Isoform 3 also disrupts XIAP/BIRC4 interacting with processed caspase-9 and promotes caspase-3 activation. Isoform 1 is defective in the capacity to down-regulate the XIAP/BIRC4 abundance.
Ubiquitinated by BIRC7/livin.
Mitochondrion.
Note: Released into the cytosol when cells undergo apoptosis.
Ubiquitously expressed with highest expression in testis. Expression is also high in heart, liver, kidney, spleen, prostate and ovary. Low in brain, lung, thymus and peripheral blood leukocytes. Isoform 3 is ubiquitously expressed.
Homodimer. Interacts with BEX3 (By similarity). Interacts with BIRC2/c-IAP1, BIRC3/c-IAP2, XIAP/BIRC4, BIRC6/bruce and BIRC7/livin. Interacts with the monomeric and dimeric form of BIRC5/survivin.
The mature N-terminus mediates interaction with XIAP/BIRC4.
Research Fields
· Cellular Processes > Cell growth and death > Apoptosis. (View pathway)
· Cellular Processes > Cell growth and death > Apoptosis - multiple species. (View pathway)
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.