IL2RG Antibody - #DF6642
Product: | IL2RG Antibody |
Catalog: | DF6642 |
Description: | Rabbit polyclonal antibody to IL2RG |
Application: | WB IHC |
Reactivity: | Human, Mouse, Rat |
Prediction: | Pig, Bovine, Sheep, Dog |
Mol.Wt.: | 42kDa; 42kD(Calculated). |
Uniprot: | P31785 |
RRID: | AB_2838604 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF6642, RRID:AB_2838604.
Fold/Unfold
CD132; CD132 antigen; CIDX; common cytokine receptor gamma chain; Cytokine receptor common subunit gamma; Gamma C; gamma(c); gammaC; IL-2 receptor subunit gamma; IL-2R gamma chain; IL-2R subunit gamma; IL-2RG; Il2rg; IL2RG_HUMAN; IMD4; interleukin 2 receptor, gamma; Interleukin-2 receptor subunit gamma; p64; SCIDX; SCIDX1;
Immunogens
- P31785 IL2RG_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MLKPSLPFTSLLFLQLPLLGVGLNTTILTPNGNEDTTADFFLTTMPTDSLSVSTLPLPEVQCFVFNVEYMNCTWNSSSEPQPTNLTLHYWYKNSDNDKVQKCSHYLFSEEITSGCQLQKKEIHLYQTFVVQLQDPREPRRQATQMLKLQNLVIPWAPENLTLHKLSESQLELNWNNRFLNHCLEHLVQYRTDWDHSWTEQSVDYRHKFSLPSVDGQKRYTFRVRSRFNPLCGSAQHWSEWSHPIHWGSNTSKENPFLFALEAVVISVGSMGLIISLLCVYFWLERTMPRIPTLKNLEDLVTEYHGNFSAWSGVSKGLAESLQPDYSERLCLVSEIPPKGGALGEGPGASPCNQHSPYWAPPCYTLKPET
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - P31785 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
N71 | N-Glycosylation | Uniprot | |
N84 | N-Glycosylation | Uniprot | |
K101 | Ubiquitination | Uniprot | |
K119 | Ubiquitination | Uniprot | |
K147 | Ubiquitination | Uniprot | |
N159 | N-Glycosylation | Uniprot | |
K164 | Ubiquitination | Uniprot | |
K207 | Ubiquitination | Uniprot | |
K217 | Ubiquitination | Uniprot | |
T292 | Phosphorylation | Uniprot | |
K294 | Ubiquitination | Uniprot | |
T301 | Phosphorylation | Uniprot | |
Y303 | Phosphorylation | Uniprot | |
S308 | Phosphorylation | Uniprot | |
K315 | Ubiquitination | Uniprot | |
S320 | Phosphorylation | Uniprot | |
Y325 | Phosphorylation | Uniprot | |
S326 | Phosphorylation | Uniprot | |
Y357 | Phosphorylation | Uniprot | |
Y363 | Phosphorylation | Uniprot |
Research Backgrounds
Common subunit for the receptors for a variety of interleukins. Probably in association with IL15RA, involved in the stimulation of neutrophil phagocytosis by IL15.
Cell membrane>Single-pass type I membrane protein. Cell surface.
The gamma subunit is common to the IL2, IL4, IL7, IL15, IL21 and probably also the IL13 receptors. Interacts with SHB upon interleukin stimulation.
(Microbial infection) Interacts with HTLV-1 accessory protein p12I.
The WSXWS motif appears to be necessary for proper protein folding and thereby efficient intracellular transport and cell-surface receptor binding.
The box 1 motif is required for JAK interaction and/or activation.
Belongs to the type I cytokine receptor family. Type 5 subfamily.
Research Fields
· Cellular Processes > Transport and catabolism > Endocytosis. (View pathway)
· Environmental Information Processing > Signaling molecules and interaction > Cytokine-cytokine receptor interaction. (View pathway)
· Environmental Information Processing > Signal transduction > PI3K-Akt signaling pathway. (View pathway)
· Environmental Information Processing > Signal transduction > Jak-STAT signaling pathway. (View pathway)
· Human Diseases > Infectious diseases: Viral > Measles.
· Human Diseases > Infectious diseases: Viral > HTLV-I infection.
· Human Diseases > Cancers: Overview > Pathways in cancer. (View pathway)
· Human Diseases > Immune diseases > Inflammatory bowel disease (IBD).
· Human Diseases > Immune diseases > Primary immunodeficiency.
· Organismal Systems > Immune system > Th1 and Th2 cell differentiation. (View pathway)
· Organismal Systems > Immune system > Th17 cell differentiation. (View pathway)
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.