CRADD Antibody - #DF6260
Product: | CRADD Antibody |
Catalog: | DF6260 |
Description: | Rabbit polyclonal antibody to CRADD |
Application: | WB IHC |
Reactivity: | Human, Mouse, Rat |
Prediction: | Pig, Bovine, Sheep, Dog, Chicken |
Mol.Wt.: | 23kDa; 23kD(Calculated). |
Uniprot: | P78560 |
RRID: | AB_2838226 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF6260, RRID:AB_2838226.
Fold/Unfold
CASP2 and RIPK1 domain containing adaptor with death domain; Caspase and RIP adapter with death domain; Caspase and RIP adaptor with death domain; Cradd; CRADD_HUMAN; Death adaptor molecule RAIDD; Death domain containing protein CRADD; Death domain-containing protein CRADD; MGC9163; RIP associated ICH1/CED3 homologous protein with death domain; RIP associated protein with a death domain; RIP-associated protein with a death domain;
Immunogens
Constitutively expressed in most tissues, with particularly high expression in adult heart, testis, liver, skeletal muscle, fetal liver and kidney.
- P78560 CRADD_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MEARDKQVLRSLRLELGAEVLVEGLVLQYLYQEGILTENHIQEINAQTTGLRKTMLLLDILPSRGPKAFDTFLDSLQEFPWVREKLKKAREEAMTDLPAGDRLTGIPSHILNSSPSDRQINQLAQRLGPEWEPMVLSLGLSQTDIYRCKANHPHNVQSQVVEAFIRWRQRFGKQATFQSLHNGLRAVEVDPSLLLHMLE
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - P78560 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
S11 | Phosphorylation | Uniprot | |
T48 | Phosphorylation | Uniprot | |
K53 | Ubiquitination | Uniprot | |
S116 | Phosphorylation | Uniprot | |
S141 | Phosphorylation | Uniprot | |
K173 | Ubiquitination | Uniprot |
Research Backgrounds
Adapter protein that associates with PIDD1 and the caspase CASP2 to form the PIDDosome, a complex that activates CASP2 and triggers apoptosis. Also recruits CASP2 to the TNFR-1 signaling complex through its interaction with RIPK1 and TRADD and may play a role in the tumor necrosis factor-mediated signaling pathway.
Cytoplasm. Nucleus.
Constitutively expressed in most tissues, with particularly high expression in adult heart, testis, liver, skeletal muscle, fetal liver and kidney.
Forms a complex named the PIDDosome with PIDD1 and CASP2. Interacts (via Death domain) with RIPK1 (via Death domain); the interaction is direct. Interacts with TRADD. Interacts with TNFRSF1A.
The Death domain mediates the interaction with PIDD1 and the formation of a complex composed of 5 PIDD1 and 7 CRADD proteins which in turn probably recruit 7 CASP2 to form the PIDDosome (PubMed:17289572). The Death domain mediates a direct interaction with the Death domain of RIPK1 (PubMed:9044836).
The CARD domain mediates a direct interaction with CASP2.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.