PPIA Antibody - #DF6175
Product: | PPIA Antibody |
Catalog: | DF6175 |
Description: | Rabbit polyclonal antibody to PPIA |
Application: | WB IHC |
Reactivity: | Human, Mouse, Rat, Monkey |
Prediction: | Pig, Bovine, Horse, Sheep, Rabbit |
Mol.Wt.: | 18kDa; 18kD(Calculated). |
Uniprot: | P62937 |
RRID: | AB_2838142 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF6175, RRID:AB_2838142.
Fold/Unfold
Cyclophilin A; Cyclophilin; CyclophilinA; Cyclosporin A binding protein; Cyclosporin A-binding protein; CYPA; CYPH; Epididymis secretory sperm binding protein Li 69p; HEL S 69p; MGC117158; MGC12404; MGC23397; Peptidyl prolyl cis trans isomerase A; Peptidyl-prolyl cis-trans isomerase A; Peptidylprolyl isomerase A (cyclophilin A); Peptidylprolyl isomerase A; PPIA; PPIA protein; PPIA_HUMAN; PPIase A; Rotamase A; RotamaseA; T cell cyclophilin;
Immunogens
- P62937 PPIA_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MVNPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITIADCGQLE
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - P62937 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
M1 | Acetylation | Uniprot | |
V2 | Acetylation | Uniprot | |
T5 | Phosphorylation | Uniprot | |
S21 | Phosphorylation | Uniprot | |
K28 | Acetylation | Uniprot | |
K28 | Ubiquitination | Uniprot | |
K31 | Acetylation | Uniprot | |
K31 | Sumoylation | Uniprot | |
K31 | Ubiquitination | Uniprot | |
S40 | Phosphorylation | Uniprot | |
K44 | Acetylation | Uniprot | |
K44 | Sumoylation | Uniprot | |
K44 | Ubiquitination | Uniprot | |
Y48 | Phosphorylation | Uniprot | |
K49 | Acetylation | Uniprot | |
K49 | Methylation | Uniprot | |
K49 | Sumoylation | Uniprot | |
K49 | Ubiquitination | Uniprot | |
S51 | Phosphorylation | Uniprot | |
C52 | S-Nitrosylation | Uniprot | |
T68 | Phosphorylation | Uniprot | |
K76 | Acetylation | Uniprot | |
K76 | Sumoylation | Uniprot | |
K76 | Ubiquitination | Uniprot | |
S77 | Phosphorylation | Uniprot | |
Y79 | Phosphorylation | Uniprot | |
K82 | Acetylation | Uniprot | |
K82 | Sumoylation | Uniprot | |
K82 | Ubiquitination | Uniprot | |
K91 | Acetylation | Uniprot | |
K91 | Methylation | Uniprot | |
K91 | Ubiquitination | Uniprot | |
T93 | Phosphorylation | Uniprot | |
S99 | Phosphorylation | Uniprot | |
T107 | Phosphorylation | Uniprot | |
S110 | Phosphorylation | Uniprot | |
T116 | Phosphorylation | Uniprot | |
K118 | Acetylation | Uniprot | |
K118 | Sumoylation | Uniprot | |
K118 | Ubiquitination | Uniprot | |
K125 | Acetylation | Uniprot | |
K125 | Methylation | Uniprot | |
K125 | Sumoylation | Uniprot | |
K125 | Ubiquitination | Uniprot | |
K131 | Acetylation | Uniprot | |
K131 | Ubiquitination | Uniprot | |
K133 | Acetylation | Uniprot | |
K133 | Sumoylation | Uniprot | |
K133 | Ubiquitination | Uniprot | |
S147 | Phosphorylation | Uniprot | |
K151 | Ubiquitination | Uniprot | |
K155 | Acetylation | Uniprot | |
K155 | Sumoylation | Uniprot | |
K155 | Ubiquitination | Uniprot | |
T157 | Phosphorylation | Uniprot | |
C161 | S-Nitrosylation | Uniprot |
Research Backgrounds
PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides.
Acetylation at Lys-125 markedly inhibits catalysis of cis to trans isomerization and stabilizes cis rather than trans forms of the HIV-1 capsid. PPIA acetylation also antagonizes the immunosuppressive effects of cyclosporine by inhibiting the sequential steps of cyclosporine binding and calcineurin inhibition.
Cytoplasm. Secreted.
Note: Secretion occurs in response to oxidative stress in vascular smooth muscle through a vesicular secretory pathway that involves actin remodeling and myosin II activation, and mediates ERK1/2 activation.
Interacts with protein phosphatase PPP3CA/calcineurin A.
(Microbial infection) Interacts with HIV-1 capsid protein.
Belongs to the cyclophilin-type PPIase family. PPIase A subfamily.
Research Fields
· Cellular Processes > Cell growth and death > Necroptosis. (View pathway)
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.