P2RY11 Antibody - #DF5138
Product: | P2RY11 Antibody |
Catalog: | DF5138 |
Description: | Rabbit polyclonal antibody to P2RY11 |
Application: | WB IF/ICC |
Reactivity: | Human |
Mol.Wt.: | 48 KD; 40kD(Calculated). |
Uniprot: | Q96G91 |
RRID: | AB_2837497 |
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF5138, RRID:AB_2837497.
Fold/Unfold
P2RY11; P2Y purinoceptor 11; P2Y11; P2Y11 receptor; P2Y11_HUMAN; Purinergic receptor P2Y G protein coupled 11; Purinergic receptor P2Y11;
Immunogens
- Q96G91 P2Y11_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MAANVSGAKSCPANFLAAADDKLSGFQGDFLWPILVVEFLVAVASNGLALYRFSIRKQRPWHPAVVFSVQLAVSDLLCALTLPPLAAYLYPPKHWRYGEAACRLERFLFTCNLLGSVIFITCISLNRYLGIVHPFFARSHLRPKHAWAVSAAGWVLAALLAMPTLSFSHLKRPQQGAGNCSVARPEACIKCLGTADHGLAAYRAYSLVLAGLGCGLPLLLTLAAYGALGRAVLRSPGMTVAEKLRVAALVASGVALYASSYVPYHIMRVLNVDARRRWSTRCPSFADIAQATAALELGPYVGYQVMRGLMPLAFCVHPLLYMAAVPSLGCCCRHCPGYRDSWNPEDAKSTGQALPLNATAAPKPSEPQSRELSQ
PTMs - Q96G91 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
T110 | Phosphorylation | Uniprot | |
S235 | Phosphorylation | Uniprot |
Research Backgrounds
Receptor for ATP and ADP coupled to G-proteins that activate both phosphatidylinositol-calcium and adenylyl cyclase second messenger systems. Not activated by UTP or UDP.
Cell membrane>Multi-pass membrane protein.
Highest expression in liver and spleen.
Belongs to the G-protein coupled receptor 1 family.
Research Fields
· Environmental Information Processing > Signaling molecules and interaction > Neuroactive ligand-receptor interaction.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.