NK3R Antibody - #DF4997
Product: | NK3R Antibody |
Catalog: | DF4997 |
Description: | Rabbit polyclonal antibody to NK3R |
Application: | WB IF/ICC |
Reactivity: | Human, Mouse, Rat |
Prediction: | Horse, Rabbit, Dog |
Mol.Wt.: | 52 KD; 52kD(Calculated). |
Uniprot: | P29371 |
RRID: | AB_2837356 |
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF4997, RRID:AB_2837356.
Fold/Unfold
MGC148060; MGC148061; Neurokinin B receptor; Neurokinin beta receptor; Neuromedin K Receptor; Neuromedin-K receptor; NK 3 receptor; NK 3R; NK-3 receptor; NK-3R; NK3 receptor; NK3R; NK3R_HUMAN; NKR; TAC 3R; TAC3R; TAC3RL; Tachykinin receptor 3; TACR 3; Tacr3;
Immunogens
- P29371 NK3R_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MATLPAAETWIDGGGGVGADAVNLTASLAAGAATGAVETGWLQLLDQAGNLSSSPSALGLPVASPAPSQPWANLTNQFVQPSWRIALWSLAYGVVVAVAVLGNLIVIWIILAHKRMRTVTNYFLVNLAFSDASMAAFNTLVNFIYALHSEWYFGANYCRFQNFFPITAVFASIYSMTAIAVDRYMAIIDPLKPRLSATATKIVIGSIWILAFLLAFPQCLYSKTKVMPGRTLCFVQWPEGPKQHFTYHIIVIILVYCFPLLIMGITYTIVGITLWGGEIPGDTCDKYHEQLKAKRKVVKMMIIVVMTFAICWLPYHIYFILTAIYQQLNRWKYIQQVYLASFWLAMSSTMYNPIIYCCLNKRFRAGFKRAFRWCPFIKVSSYDELELKTTRFHPNRQSSMYTVTRMESMTVVFDPNDADTTRSSRKKRATPRDPSFNGCSRRNSKSASATSSFISSPYTSVDEYS
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - P29371 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
S399 | Phosphorylation | Uniprot | |
T404 | Phosphorylation | Uniprot | |
T410 | Phosphorylation | Uniprot |
Research Backgrounds
This is a receptor for the tachykinin neuropeptide neuromedin-K (neurokinin B). It is associated with G proteins that activate a phosphatidylinositol-calcium second messenger system. The rank order of affinity of this receptor to tachykinins is: neuromedin-K > substance K > substance P.
The anchoring of this receptor to the plasma membrane is probably mediated by the palmitoylation of a cysteine residue.
Cell membrane>Multi-pass membrane protein.
Belongs to the G-protein coupled receptor 1 family.
Research Fields
· Environmental Information Processing > Signal transduction > Calcium signaling pathway. (View pathway)
· Environmental Information Processing > Signaling molecules and interaction > Neuroactive ligand-receptor interaction.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.