CLTR2 Antibody - #DF4917
Product: | CLTR2 Antibody |
Catalog: | DF4917 |
Description: | Rabbit polyclonal antibody to CLTR2 |
Application: | WB IHC IF/ICC |
Reactivity: | Human |
Mol.Wt.: | 35 KD; 40kD(Calculated). |
Uniprot: | Q9NS75 |
RRID: | AB_2837270 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF4917, RRID:AB_2837270.
Fold/Unfold
CLTR2_HUMAN; CYSLT2; CYSLT2R; CYSLTR 2; CysLTR2; Cysteinyl leukotriene CysLT2 receptor; Cysteinyl leukotriene receptor 2; G protein coupled receptor; G protein coupled receptor GPCR21; G protein coupled receptor HG57; G-protein coupled receptor GPCR21; G-protein coupled receptor HG57; GPCR; HG57; hGPCR21; HPN321; PSEC0146;
Immunogens
Widely expressed, with highest levels in the heart, placenta, spleen, peripheral blood leukocytes and adrenal gland. In lung, expressed in the interstitial macrophages, and slightly in smooth muscle cells.
- Q9NS75 CLTR2_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MERKFMSLQPSISVSEMEPNGTFSNNNSRNCTIENFKREFFPIVYLIIFFWGVLGNGLSIYVFLQPYKKSTSVNVFMLNLAISDLLFISTLPFRADYYLRGSNWIFGDLACRIMSYSLYVNMYSSIYFLTVLSVVRFLAMVHPFRLLHVTSIRSAWILCGIIWILIMASSIMLLDSGSEQNGSVTSCLELNLYKIAKLQTMNYIALVVGCLLPFFTLSICYLLIIRVLLKVEVPESGLRVSHRKALTTIIITLIIFFLCFLPYHTLRTVHLTTWKVGLCKDRLHKALVITLALAAANACFNPLLYYFAGENFKDRLKSALRKGHPQKAKTKCVFPVSVWLRKETRV
PTMs - Q9NS75 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
K280 | Sumoylation | Uniprot |
Research Backgrounds
Receptor for cysteinyl leukotrienes. The response is mediated via a G-protein that activates a phosphatidylinositol-calcium second messenger system. Stimulation by BAY u9773, a partial agonist, induces specific contractions of pulmonary veins and might also have an indirect role in the relaxation of the pulmonary vascular endothelium. The rank order of affinities for the leukotrienes is LTC4 = LTD4 >> LTE4.
Cell membrane>Multi-pass membrane protein.
Widely expressed, with highest levels in the heart, placenta, spleen, peripheral blood leukocytes and adrenal gland. In lung, expressed in the interstitial macrophages, and slightly in smooth muscle cells.
Belongs to the G-protein coupled receptor 1 family.
Research Fields
· Environmental Information Processing > Signal transduction > Calcium signaling pathway. (View pathway)
· Environmental Information Processing > Signaling molecules and interaction > Neuroactive ligand-receptor interaction.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.