CLTR1 Antibody - #DF4916
Product: | CLTR1 Antibody |
Catalog: | DF4916 |
Description: | Rabbit polyclonal antibody to CLTR1 |
Application: | WB IF/ICC |
Reactivity: | Human, Monkey |
Prediction: | Pig, Horse, Sheep, Rabbit, Dog |
Mol.Wt.: | 36 KD; 39kD(Calculated). |
Uniprot: | Q9Y271 |
RRID: | AB_2837269 |
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF4916, RRID:AB_2837269.
Fold/Unfold
CLTR1_HUMAN; CYSLT 1; CysLT(1); CYSLT1R; CYSLTR 1; CYSLTR; CysLTR vide supra; CysLTR1; Cysteinyl leukotriene D4 receptor; Cysteinyl leukotriene receptor 1; G-protein coupled receptor HG55; HG55; HMTMF81; LTD4 receptor; MGC46139;
Immunogens
Widely expressed, with highest levels in spleen and peripheral blood leukocytes. Lower expression in several tissues, such as lung (mostly in smooth muscle bundles and alveolar macrophages), placenta, small intestine, pancreas, colon and heart.
- Q9Y271 CLTR1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MDETGNLTVSSATCHDTIDDFRNQVYSTLYSMISVVGFFGNGFVLYVLIKTYHKKSAFQVYMINLAVADLLCVCTLPLRVVYYVHKGIWLFGDFLCRLSTYALYVNLYCSIFFMTAMSFFRCIAIVFPVQNINLVTQKKARFVCVGIWIFVILTSSPFLMAKPQKDEKNNTKCFEPPQDNQTKNHVLVLHYVSLFVGFIIPFVIIIVCYTMIILTLLKKSMKKNLSSHKKAIGMIMVVTAAFLVSFMPYHIQRTIHLHFLHNETKPCDSVLRMQKSVVITLSLAASNCCFDPLLYFFSGGNFRKRLSTFRKHSLSSVTYVPRKKASLPEKGEEICKV
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q9Y271 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
T8 | Phosphorylation | Uniprot | |
S10 | Phosphorylation | Uniprot | |
S307 | Phosphorylation | Uniprot | |
T308 | Phosphorylation | Uniprot | |
S313 | Phosphorylation | Uniprot | |
S315 | Phosphorylation | Uniprot | |
S316 | Phosphorylation | Uniprot | |
S326 | Phosphorylation | Uniprot |
Research Backgrounds
Receptor for cysteinyl leukotrienes mediating bronchoconstriction of individuals with and without asthma. Stimulation by LTD4 results in the contraction and proliferation of smooth muscle, edema, eosinophil migration and damage to the mucus layer in the lung. This response is mediated via a G-protein that activates a phosphatidylinositol-calcium second messenger system. The rank order of affinities for the leukotrienes is LTD4 >> LTE4 = LTC4 >> LTB4.
Cell membrane>Multi-pass membrane protein.
Widely expressed, with highest levels in spleen and peripheral blood leukocytes. Lower expression in several tissues, such as lung (mostly in smooth muscle bundles and alveolar macrophages), placenta, small intestine, pancreas, colon and heart.
Belongs to the G-protein coupled receptor 1 family.
Research Fields
· Environmental Information Processing > Signal transduction > Calcium signaling pathway. (View pathway)
· Environmental Information Processing > Signaling molecules and interaction > Neuroactive ligand-receptor interaction.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.