EWSR1 Antibody - #DF4447
Product: | EWSR1 Antibody |
Catalog: | DF4447 |
Description: | Rabbit polyclonal antibody to EWSR1 |
Application: | WB IF/ICC |
Reactivity: | Human, Mouse, Rat |
Prediction: | Pig, Bovine, Horse, Sheep, Dog, Chicken |
Mol.Wt.: | 68 KD; 68kD(Calculated). |
Uniprot: | Q01844 |
RRID: | AB_2836802 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF4447, RRID:AB_2836802.
Fold/Unfold
bK984G1.4; bK984G1.4 Ewing sarcoma breakpoint region 1 protein; Ewing sarcoma breakpoint region 1; Ewing sarcoma breakpoint region 1 protein; Ewings sarcoma EWS Fli1 type 1 oncogene; EWS; EWS oncogene; EWS RNA binding protein 1; EWS_HUMAN; EWSR 1; Ewsr1; EWSR1 protein; RNA binding protein EWS; RNA-binding protein EWS;
Immunogens
- Q01844 EWS_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MASTDYSTYSQAAAQQGYSAYTAQPTQGYAQTTQAYGQQSYGTYGQPTDVSYTQAQTTATYGQTAYATSYGQPPTGYTTPTAPQAYSQPVQGYGTGAYDTTTATVTTTQASYAAQSAYGTQPAYPAYGQQPAATAPTRPQDGNKPTETSQPQSSTGGYNQPSLGYGQSNYSYPQVPGSYPMQPVTAPPSYPPTSYSSTQPTSYDQSSYSQQNTYGQPSSYGQQSSYGQQSSYGQQPPTSYPPQTGSYSQAPSQYSQQSSSYGQQSSFRQDHPSSMGVYGQESGGFSGPGENRSMSGPDNRGRGRGGFDRGGMSRGGRGGGRGGMGSAGERGGFNKPGGPMDEGPDLDLGPPVDPDEDSDNSAIYVQGLNDSVTLDDLADFFKQCGVVKMNKRTGQPMIHIYLDKETGKPKGDATVSYEDPPTAKAAVEWFDGKDFQGSKLKVSLARKKPPMNSMRGGLPPREGRGMPPPLRGGPGGPGGPGGPMGRMGGRGGDRGGFPPRGPRGSRGNPSGGGNVQHRAGDWQCPNPGCGNQNFAWRTECNQCKAPKPEGFLPPPFPPPGGDRGRGGPGGMRGGRGGLMDRGGPGGMFRGGRGGDRGGFRGGRGMDRGGFGGGRRGGPGGPPGPLMEQMGGRRGGRGGPGKMDKGEHRQERRDRPY
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q01844 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
T79 | Phosphorylation | P45983 (MAPK8) , P28482 (MAPK1) , Q13535 (ATR) , Q13315 (ATM) , Q16539 (MAPK14) , Q15759 (MAPK11) , P27361 (MAPK3) | Uniprot |
S266 | Phosphorylation | P05771 (PRKCB) , P17252 (PRKCA) | Uniprot |
Y278 | Phosphorylation | P12931 (SRC) | Uniprot |
S286 | Phosphorylation | Uniprot | |
R292 | Methylation | Uniprot | |
R300 | Methylation | Uniprot | |
R302 | Methylation | Uniprot | |
R304 | Methylation | Uniprot | |
R309 | Methylation | Uniprot | |
R314 | Methylation | Uniprot | |
R317 | Methylation | Uniprot | |
R321 | Methylation | Uniprot | |
R330 | Methylation | Uniprot | |
S371 | Phosphorylation | Uniprot | |
Y417 | Phosphorylation | Uniprot | |
T422 | Phosphorylation | Uniprot | |
K424 | Ubiquitination | Uniprot | |
K433 | Acetylation | Uniprot | |
K433 | Ubiquitination | Uniprot | |
K439 | Acetylation | Uniprot | |
K439 | Ubiquitination | Uniprot | |
S443 | Phosphorylation | Uniprot | |
R455 | Methylation | Uniprot | |
R461 | Methylation | Uniprot | |
R464 | Methylation | Uniprot | |
R471 | Methylation | Uniprot | |
R486 | Methylation | Uniprot | |
R490 | Methylation | Uniprot | |
R494 | Methylation | Uniprot | |
R500 | Methylation | Uniprot | |
R503 | Methylation | Uniprot | |
R506 | Methylation | Uniprot | |
R563 | Methylation | Uniprot | |
R565 | Methylation | Uniprot | |
R572 | Methylation | Uniprot | |
R575 | Methylation | Uniprot | |
R581 | Methylation | Uniprot | |
R589 | Methylation | Uniprot | |
R592 | Methylation | Uniprot | |
R596 | Methylation | Uniprot | |
R600 | Methylation | Uniprot | |
R603 | Methylation | Uniprot | |
R607 | Methylation | Uniprot | |
R614 | Methylation | Uniprot | |
R615 | Methylation | Uniprot | |
R632 | Methylation | Uniprot | |
R633 | Methylation | Uniprot | |
R636 | Methylation | Uniprot | |
Y656 | Phosphorylation | Uniprot |
Research Backgrounds
Might normally function as a transcriptional repressor. EWS-fusion-proteins (EFPS) may play a role in the tumorigenic process. They may disturb gene expression by mimicking, or interfering with the normal function of CTD-POLII within the transcription initiation complex. They may also contribute to an aberrant activation of the fusion protein target genes.
Phosphorylated; calmodulin-binding inhibits phosphorylation of Ser-266.
Highly methylated on arginine residues. Methylation is mediated by PRMT1 and, at lower level by PRMT8.
Nucleus. Cytoplasm. Cell membrane.
Note: Relocates from cytoplasm to ribosomes upon PTK2B/FAK2 activation.
Ubiquitous.
Binds POLR2C, SF1, calmodulin and RNA. Interacts with PTK2B/FAK2 and TDRD3. Binds calmodulin in the presence, but not in the absence, of calcium ion. Forms a complex with REC8, PRDM9, SYCP3 and SYCP1; complex formation is dependent of phosphorylated form of REC8 and requires PRDM9 bound to hotspot DNA; EWSR1 joins PRDM9 with the chromosomal axis through REC8 (By similarity).
EWS activation domain (EAD) functions as a potent activation domain in EFPS. EWSR1 binds POLR2C but not POLR2E or POLR2G, whereas the isolated EAD binds POLR2E and POLR2G but not POLR2C. Cis-linked RNA-binding domain (RBD) can strongly and specifically repress trans-activation by the EAD.
Belongs to the RRM TET family.
Research Fields
· Human Diseases > Cancers: Overview > Transcriptional misregulation in cancer.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.