RAP2C Antibody - #DF4411
Product: | RAP2C Antibody |
Catalog: | DF4411 |
Description: | Rabbit polyclonal antibody to RAP2C |
Application: | WB IHC IF/ICC |
Reactivity: | Human, Mouse, Rat |
Prediction: | Pig, Zebrafish, Bovine, Horse, Sheep, Rabbit, Dog, Xenopus |
Mol.Wt.: | 26 KD; 21kD(Calculated). |
Uniprot: | Q9Y3L5 |
RRID: | AB_2836766 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF4411, RRID:AB_2836766.
Fold/Unfold
2010200P20Rik; AI194294; AL022976; BOS_25229; DKFZp313B211; MGC143331; OTTHUMP00000024037; OTTMUSP00000019067; RAP2C; RAP2C, member of RAS oncogene family; RAP2C_HUMAN; Ras related protein Rap 2c; Ras-related protein Rap-2c; RP23-15D12.2;
Immunogens
Expressed in liver, skeletal muscle, prostate, uterus, rectum, stomach, and bladder and to a lower extent in brain, kidney, pancreas, and bone marrow. Expressed in mononuclear leukocytes and megakaryocytes.
- Q9Y3L5 RAP2C_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MREYKVVVLGSGGVGKSALTVQFVTGTFIEKYDPTIEDFYRKEIEVDSSPSVLEILDTAGTEQFASMRDLYIKNGQGFILVYSLVNQQSFQDIKPMRDQIVRVKRYEKVPLILVGNKVDLEPEREVMSSEGRALAQEWGCPFMETSAKSKSMVDELFAEIVRQMNYSSLPEKQDQCCTTCVVQ
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q9Y3L5 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
Y4 | Phosphorylation | Uniprot | |
K5 | Ubiquitination | Uniprot | |
S11 | Phosphorylation | Uniprot | |
S17 | Phosphorylation | Uniprot | |
T20 | Phosphorylation | Uniprot | |
T25 | Phosphorylation | Uniprot | |
T27 | Phosphorylation | Uniprot | |
K31 | Ubiquitination | Uniprot | |
Y40 | Phosphorylation | Uniprot | |
K42 | Ubiquitination | Uniprot | |
T61 | Phosphorylation | Uniprot | |
S66 | Phosphorylation | Uniprot | |
Y106 | Phosphorylation | Uniprot | |
K108 | Ubiquitination | Uniprot | |
K117 | Ubiquitination | Uniprot | |
K148 | Ubiquitination | Uniprot | |
Y166 | Phosphorylation | Uniprot |
Research Backgrounds
Small GTP-binding protein which cycles between a GDP-bound inactive and a GTP-bound active form. May play a role in cytoskeletal rearrangements and regulate cell spreading through activation of the effector TNIK. May play a role in SRE-mediated gene transcription.
Palmitoylated. Palmitoylation is required for association with recycling endosome membranes and activation of TNIK.
Cytoplasm. Recycling endosome membrane>Lipid-anchor>Cytoplasmic side.
Expressed in liver, skeletal muscle, prostate, uterus, rectum, stomach, and bladder and to a lower extent in brain, kidney, pancreas, and bone marrow. Expressed in mononuclear leukocytes and megakaryocytes.
Belongs to the small GTPase superfamily. Ras family.
Research Fields
· Cellular Processes > Cellular community - eukaryotes > Tight junction. (View pathway)
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.