DNAL1 Antibody - #DF4014
Product: | DNAL1 Antibody |
Catalog: | DF4014 |
Description: | Rabbit polyclonal antibody to DNAL1 |
Application: | WB IF/ICC |
Reactivity: | Human, Mouse |
Prediction: | Pig, Zebrafish, Bovine, Horse, Sheep, Rabbit, Dog, Xenopus |
Mol.Wt.: | 22 KD; 22kD(Calculated). |
Uniprot: | Q4LDG9 |
RRID: | AB_2836374 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF4014, RRID:AB_2836374.
Fold/Unfold
axonemal; Axonemal dynein light chain 1; Axonemal dynein light chain; C14orf168; Chromosome 14 open reading frame 168; CILD16; DNAL 1; dnal1; DNAL1_HUMAN; Dynein axonemal light chain 1; Dynein light chain 1; Dynein light chain 1 axonemal; MGC12435;
Immunogens
Expressed in tissues carrying motile cilia such as respiratory epithelia, ependyma and testis.
- Q4LDG9 DNAL1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MAKATTIKEALARWEEKTGQRPSEAKEIKLYAQIPPIEKMDASLSMLANCEKLSLSTNCIEKIANLNGLKNLRILSLGRNNIKNLNGLEAVGDTLEELWISYNFIEKLKGIHIMKKLKILYMSNNLVKDWAEFVKLAELPCLEDLVFVGNPLEEKHSAENNWIEEATKRVPKLKKLDGTPVIKGDEEEDN
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q4LDG9 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
A2 | Acetylation | Uniprot | |
K8 | Ubiquitination | Uniprot | |
T18 | Phosphorylation | Uniprot | |
S23 | Phosphorylation | Uniprot | |
Y31 | Phosphorylation | Uniprot | |
S56 | Phosphorylation | Uniprot | |
K109 | Ubiquitination | Uniprot | |
K155 | Ubiquitination | Uniprot |
Research Backgrounds
Part of the multisubunit axonemal ATPase complexes that generate the force for cilia motility and govern beat frequency (By similarity). Component of the outer arm dynein (ODA). May be involved in a mechanosensory feedback mechanism controlling ODA activity based on external conformational cues by tethering the outer arm dynein heavy chain (DNAH5) to the microtubule within the axoneme (By similarity). Important for ciliary function in the airways and for the function of the cilia that produce the nodal flow essential for the determination of the left-right asymmetry.
Cytoplasm>Cytoskeleton>Cilium axoneme.
Expressed in tissues carrying motile cilia such as respiratory epithelia, ependyma and testis.
Interacts with ZMYND10 (via C-terminus). Interacts with DNAH5, a outer arm dynein heavy chain. Interacts with tubulin located within the A-tubule of the outer doublets in a ATP-independent manner.
Belongs to the dynein light chain LC1-type family.
Research Fields
· Human Diseases > Neurodegenerative diseases > Huntington's disease.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.