Product: CRMP-1 Mouse Monoclonal Antibody
Catalog: BF8868
Description: Mouse monoclonal antibody to CRMP-1
Application: WB
Reactivity: Human
Prediction: Mouse, Rat, Pig, Zebrafish, Bovine, Horse, Sheep, Rabbit, Dog, Chicken
Mol.Wt.: 62KD; 62kD(Calculated).
Uniprot: Q14194

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Mouse
Application:
WB 1:500-1:3000
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human
Clonality:
Monoclonal [AFfirm8868]
Specificity:
CRMP-1 Mouse Monoclonal Antibody detects endogenous levels of total CRMP-1.
Conjugate:
Unconjugated.
Purification:
Affinity-chromatography.
Storage:
Mouse IgG1 in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

Collapsin response mediator protein 1; CRMP 1; CRMP-1; Crmp1; Dihydropyrimidinase like 1; Dihydropyrimidinase related protein 1; Dihydropyrimidinase-related protein 1; DPYL1_HUMAN; DPYSL1; DRP 1; DRP-1; DRP1; ULIP-3; Ulip3; Unc-33-like phosphoprotein 3;

Immunogens

Immunogen:
Uniprot:
Gene(ID):
Expression:
Sequence:
MSYQGKKSIPHITSDRLLIKGGRIINDDQSLYADVYLEDGLIKQIGENLIVPGGVKTIEANGRMVIPGGIDVNTYLQKPSQGMTAADDFFQGTRAALVGGTTMIIDHVVPEPGSSLLTSFEKWHEAADTKSCCDYSLHVDITSWYDGVREELEVLVQDKGVNSFQVYMAYKDVYQMSDSQLYEAFTFLKGLGAVILVHAENGDLIAQEQKRILEMGITGPEGHALSRPEELEAEAVFRAITIAGRINCPVYITKVMSKSAADIIALARKKGPLVFGEPIAASLGTDGTHYWSKNWAKAAAFVTSPPLSPDPTTPDYLTSLLACGDLQVTGSGHCPYSTAQKAVGKDNFTLIPEGVNGIEERMTVVWDKAVATGKMDENQFVAVTSTNAAKIFNLYPRKGRIAVGSDADVVIWDPDKLKTITAKSHKSAVEYNIFEGMECHGSPLVVISQGKIVFEDGNINVNKGMGRFIPRKAFPEHLYQRVKIRNKVFGLQGVSRGMYDGPVYEVPATPKYATPAPSAKSSPSKHQPPPIRNLHQSNFSLSGAQIDDNNPRRTGHRIVAPPGGRSNITSLG

PTMs - Q14194 As Substrate

Site PTM Type Enzyme
Phosphorylation
S2 Phosphorylation
S8 Phosphorylation
S14 Phosphorylation
Y32 Phosphorylation
T101 Phosphorylation O14965 (AURKA)
T102 Phosphorylation O14965 (AURKA)
T253 Phosphorylation
S257 Phosphorylation
S259 Phosphorylation
S304 Phosphorylation
S308 Phosphorylation
K374 Ubiquitination
S385 Phosphorylation
K398 Acetylation
Y499 Phosphorylation
Y504 Phosphorylation P06241 (FYN)
T509 Phosphorylation P24941 (CDK2) , Q00535 (CDK5) , P49841 (GSK3B)
Y512 Phosphorylation
T514 Phosphorylation P49841 (GSK3B)
S518 Phosphorylation P49841 (GSK3B)
S521 Phosphorylation
S522 Phosphorylation Q00535 (CDK5) , Q92630 (DYRK2)
S524 Phosphorylation
S542 Phosphorylation
T569 Phosphorylation
S570 Phosphorylation

Research Backgrounds

Function:

Necessary for signaling by class 3 semaphorins and subsequent remodeling of the cytoskeleton. Plays a role in axon guidance. During the axon guidance process, acts downstream of SEMA3A to promote FLNA dissociation from F-actin which results in the rearrangement of the actin cytoskeleton and the collapse of the growth cone. Involved in invasive growth and cell migration. May participate in cytokinesis.

PTMs:

Phosphorylation at Ser-522 enhances CRMP1-mediated alteration of FLNA ternary structure and FLNA dissociation from F-actin.

Subcellular Location:

Cytoplasm. Cytoplasm>Cytoskeleton>Microtubule organizing center>Centrosome. Cytoplasm>Cytoskeleton>Spindle. Cell projection>Growth cone. Cytoplasm>Cytoskeleton. Perikaryon.
Note: Associated with centrosomes and the mitotic spindle during metaphase (PubMed:11562390). Colocalizes with FLNA and tubulin in the central region of DRG neuron growth cone (By similarity). Following SEMA3A stimulation of DRG neurons, colocalizes with F-actin (By similarity).

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Brain.

Subunit Structure:

Homotetramer, and heterotetramer with DPYSL2, DPYSL3, DPYSL4 or DPYSL5 (By similarity). Interacts with PLXNA1 (By similarity). Interacts with FLNA (via calponin-homology (CH) domain 1 and filamin repeat 24); the interaction alters FLNA ternary structure and thus promotes FLNA dissociation from F-actin.

Family&Domains:

Belongs to the metallo-dependent hydrolases superfamily. Hydantoinase/dihydropyrimidinase family.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.