TIMP1 Antibody - #AF7007
Product: | TIMP1 Antibody |
Catalog: | AF7007 |
Description: | Rabbit polyclonal antibody to TIMP1 |
Application: | WB IHC IF/ICC |
Reactivity: | Human, Mouse, Rat |
Prediction: | Pig, Bovine, Horse, Sheep, Dog |
Mol.Wt.: | 24kDa; 23kD(Calculated). |
Uniprot: | P01033 |
RRID: | AB_2835315 |
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# AF7007, RRID:AB_2835315.
Fold/Unfold
Clgi; Collagenase inhibitor; Collagenase inhibitor, Human; EPA; EPO; Erythroid Potentiating Activity; Erythroid-potentiating activity; Fibroblast collagenase inhibitor; FLJ90373; HCI; Human Collagenase Inhibitor; Metalloproteinase inhibitor 1; Metalloproteinase inhibitor 1 precursor; OTTHUMP00000023214; TIMP 1; TIMP; TIMP metallopeptidase inhibitor 1; TIMP-1; Timp1; TIMP1 protein; TIMP1_HUMAN; Tissue Inhibitor of Metalloproteinase 1; Tissue inhibitor of metalloproteinases 1; Tissue inhibitor of metalloproteinases; Ttissue inhibitor of metalloproteinase 1 erythroid potentiating activity collagenase inhibitor;
Immunogens
- P01033 TIMP1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MAPFEPLASGILLLLWLIAPSRACTCVPPHPQTAFCNSDLVIRAKFVGTPEVNQTTLYQRYEIKMTKMYKGFQALGDAADIRFVYTPAMESVCGYFHRSHNRSEEFLIAGKLQDGLLHITTCSFVAPWNSLSLAQRRGFTKTYTVGCEECTVFPCLSIPCKLQSGTHCLWTDQLLQGSEKGFQSRHLACLPREPGLCTWQSLRSQIA
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - P01033 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
K45 | Ubiquitination | Uniprot | |
K70 | Ubiquitination | Uniprot | |
S178 | Phosphorylation | Uniprot | |
K180 | Ubiquitination | Uniprot |
Research Backgrounds
Metalloproteinase inhibitor that functions by forming one to one complexes with target metalloproteinases, such as collagenases, and irreversibly inactivates them by binding to their catalytic zinc cofactor. Acts on MMP1, MMP2, MMP3, MMP7, MMP8, MMP9, MMP10, MMP11, MMP12, MMP13 and MMP16. Does not act on MMP14. Also functions as a growth factor that regulates cell differentiation, migration and cell death and activates cellular signaling cascades via CD63 and ITGB1. Plays a role in integrin signaling. Mediates erythropoiesis in vitro; but, unlike IL3, it is species-specific, stimulating the growth and differentiation of only human and murine erythroid progenitors.
The activity of TIMP1 is dependent on the presence of disulfide bonds.
N-glycosylated.
Secreted.
Detected in rheumatoid synovial fluid (at protein level).
Interacts with MMP1, MMP3, MMP10 and MMP13, but has only very low affinity for MMP14. Interacts with CD63; identified in a complex with CD63 and ITGB1.
Belongs to the protease inhibitor I35 (TIMP) family.
Research Fields
· Environmental Information Processing > Signal transduction > HIF-1 signaling pathway. (View pathway)
References
Application: WB Species: rat Sample: HSC-t6 cells
Application: WB Species: rat Sample: livers
Application: WB Species: Mouse Sample: mHSC
Application: IHC Species: Human Sample: cardinal ligament tissues
Application: WB Species: Rat Sample: HSCs
Application: WB Species: Rat Sample: pulmonary tissue
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.