ZMYND19 Antibody - #DF15952
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Fold/Unfold
MCH-R1-interacting zinc finger protein; MCHR1 interacting zinc finger protein; Melanin concentrating hormone receptor 1 interacting zinc finger protein; Melanin-concentrating hormone receptor 1-interacting zinc finger protein; MIZIP; RP11 48C7.4; Zinc finger MYND domain containing 19; Zinc finger MYND domain-containing protein 19; zinc finger MYND type containing 19; ZMY19_HUMAN; ZMYND19;
Immunogens
A synthesized peptide derived from human ZMYND19.
Expressed in brain, testis, placenta, heart, liver, skeletal muscle, kidney and stomach.
- Q96E35 ZMY19_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MTDFKLGIVRLGRVAGKTKYTLIDEQDIPLVESYSFEARMEVDADGNGAKIFAYAFDKNRGRGSGRLLHELLWERHRGGVAPGFQVVHLNAVTVDNRLDNLQLVPWGWRPKAEETSSKQREQSLYWLAIQQLPTDPIEEQFPVLNVTRYYNANGDVVEEEENSCTYYECHYPPCTVIEKQLREFNICGRCQVARYCGSQCQQKDWPAHKKHCRERKRPFQHELEPER
Research Backgrounds
May be involved as a regulatory molecule in GPR24/MCH-R1 signaling.
Cytoplasm. Cell membrane>Peripheral membrane protein.
Expressed in brain, testis, placenta, heart, liver, skeletal muscle, kidney and stomach.
Interacts with GPR24/MCH-R1.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.