PEA15 Antibody - #AF6963
Product: | PEA15 Antibody |
Catalog: | AF6963 |
Description: | Rabbit polyclonal antibody to PEA15 |
Application: | ELISA(peptide) |
Reactivity: | Human, Mouse |
Mol.Wt.: | 15kD(Calculated). |
Uniprot: | Q15121 |
RRID: | AB_2847753 |
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# AF6963, RRID:AB_2847753.
Fold/Unfold
15 kDa phosphoprotein enriched in astrocytes; Astrocytic phosphoprotein PEA 15; Astrocytic phosphoprotein PEA-15; Astrocytic phosphoprotein PEA15; HMAT 1; HMAT1; Homolog of mouse MAT 1 oncogene; Homolog of mouse MAT1 oncogene; HUMMAT 1H; HUMMAT1H; MAT 1; MAT 1H; MAT1; MAT1H; PEA 15; Pea15; PEA15 protein; PEA15_HUMAN; PED; Phosphoprotein enriched in astrocytes 15; Phosphoprotein enriched in astrocytes 15kD; Phosphoprotein enriched in diabetes;
Immunogens
A synthesized peptide derived from human PEA15.
Ubiquitously expressed. Most abundant in tissues such as heart, brain, muscle and adipose tissue which utilize glucose as an energy source. Lower expression in glucose-producing tissues. Higher levels of expression are found in tissues from individuals with type 2 diabetes than in controls.
- Q15121 PEA15_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MAEYGTLLQDLTNNITLEDLEQLKSACKEDIPSEKSEEITTGSAWFSFLESHNKLDKDNLSYIEHIFEISRRPDLLTMVVDYRTRVLKISEEDELDTKLTRIPSAKKYKDIIRQPSEEEIIKLAPPPKKA
PTMs - Q15121 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
Y4 | Phosphorylation | Uniprot | |
T6 | Phosphorylation | Uniprot | |
K24 | Ubiquitination | Uniprot | |
S25 | Phosphorylation | Uniprot | |
C27 | S-Nitrosylation | Uniprot | |
K28 | Ubiquitination | Uniprot | |
S43 | Phosphorylation | Uniprot | |
K54 | Ubiquitination | Uniprot | |
S61 | Phosphorylation | Uniprot | |
S90 | Phosphorylation | Uniprot | |
T97 | Phosphorylation | Uniprot | |
K98 | Ubiquitination | Uniprot | |
T100 | Phosphorylation | Uniprot | |
S104 | Phosphorylation | P17252 (PRKCA) | Uniprot |
Y108 | Phosphorylation | Uniprot | |
K109 | Methylation | Uniprot | |
S116 | Phosphorylation | P31749 (AKT1) , Q9UQM7 (CAMK2A) , P54646 (PRKAA2) | Uniprot |
Research Backgrounds
Blocks Ras-mediated inhibition of integrin activation and modulates the ERK MAP kinase cascade. Inhibits RPS6KA3 activities by retaining it in the cytoplasm (By similarity). Inhibits both TNFRSF6- and TNFRSF1A-mediated CASP8 activity and apoptosis. Regulates glucose transport by controlling both the content of SLC2A1 glucose transporters on the plasma membrane and the insulin-dependent trafficking of SLC2A4 from the cell interior to the surface.
Phosphorylated by protein kinase C and calcium-calmodulin-dependent protein kinase. These phosphorylation events are modulated by neurotransmitters or hormones.
Cytoplasm.
Note: Associated with microtubules.
Ubiquitously expressed. Most abundant in tissues such as heart, brain, muscle and adipose tissue which utilize glucose as an energy source. Lower expression in glucose-producing tissues. Higher levels of expression are found in tissues from individuals with type 2 diabetes than in controls.
Binds RPS6KA3, MAPK3 and MAPK1. Transient interaction with PLD1 and PLD2 (By similarity). Interacts with CASP8 and FADD.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.