QKI Antibody - #DF12715
Product: | QKI Antibody |
Catalog: | DF12715 |
Description: | Rabbit polyclonal antibody to QKI |
Application: | WB IF/ICC |
Reactivity: | Human, Mouse, Rat |
Prediction: | Pig, Bovine, Horse, Sheep, Rabbit, Dog, Chicken |
Mol.Wt.: | 38 kDa; 38kD(Calculated). |
Uniprot: | Q96PU8 |
RRID: | AB_2845676 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF12715, RRID:AB_2845676.
Fold/Unfold
DKFZp586I0923; HKQ; Homolog of mouse quaking QKI KH domain RNA binding protein; Hqk; HQK1; HqkI; OTTHUMP00000017581; OTTHUMP00000017582; OTTHUMP00000017583; Protein quaking; QK; QK1; QK3; QKI; QKI_HUMAN; QKI1; Quaking homolog; Quaking homolog KH domain RNA binding; Quaking homolog KH domain RNA binding mouse; Quaking isoform 1; Quaking protein; RNA binding protein HQK;
Immunogens
Expressed in the frontal cortex of brain. Down-regulated in the brain of schizophrenic patients.
- Q96PU8 QKI_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MVGEMETKEKPKPTPDYLMQLMNDKKLMSSLPNFCGIFNHLERLLDEEISRVRKDMYNDTLNGSTEKRSAELPDAVGPIVQLQEKLYVPVKEYPDFNFVGRILGPRGLTAKQLEAETGCKIMVRGKGSMRDKKKEEQNRGKPNWEHLNEDLHVLITVEDAQNRAEIKLKRAVEEVKKLLVPAAEGEDSLKKMQLMELAILNGTYRDANIKSPALAFSLAATAQAAPRIITGPAPVLPPAALRTPTPAGPTIMPLIRQIQTAVMPNGTPHPTAAIVPPGPEAGLIYTPYEYPYTLAPATSILEYPIEPSGVLGAVATKVRRHDMRVHPYQRIVTADRAATGN
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q96PU8 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
K10 | Ubiquitination | Uniprot | |
K25 | Ubiquitination | Uniprot | |
K26 | Ubiquitination | Uniprot | |
T60 | Phosphorylation | Uniprot | |
S64 | Phosphorylation | Uniprot | |
T65 | Phosphorylation | Uniprot | |
K67 | Ubiquitination | Uniprot | |
S69 | Phosphorylation | Uniprot | |
K91 | Ubiquitination | Uniprot | |
K111 | Ubiquitination | Uniprot | |
S188 | Phosphorylation | Uniprot | |
K190 | Ubiquitination | Uniprot | |
T203 | Phosphorylation | Uniprot | |
K210 | Ubiquitination | Uniprot | |
S211 | Phosphorylation | Uniprot | |
R227 | Methylation | Uniprot | |
R242 | Methylation | Uniprot | |
T243 | Phosphorylation | Uniprot | |
T245 | Phosphorylation | Uniprot | |
R256 | Methylation | Uniprot | |
R336 | Methylation | Uniprot |
Research Backgrounds
RNA-binding protein that plays a central role in myelinization. Binds to the 5'-NACUAAY-N(1,20)-UAAY-3' RNA core sequence. Regulates target mRNA stability. In addition, acts by regulating pre-mRNA splicing, mRNA export and protein translation. Required to protect and promote stability of mRNAs such as MBP and CDKN1B. Regulator of oligodendrocyte differentiation and maturation in the brain that may play a role in myelin and oligodendrocyte dysfunction in schizophrenia. Participates in mRNA transport by regulating the nuclear export of MBP mRNA. Also involved in regulation of mRNA splicing of MAG pre-mRNA. Acts as a translational repressor (By similarity).
Methylated by PRMT1.
Tyrosine phosphorylated at its C-terminus, probably by FYN. Phosphorylation leads to decreased mRNA-binding affinity, affecting transport and/or stabilization of MBP mRNA (By similarity).
Nucleus. Cytoplasm.
Expressed in the frontal cortex of brain. Down-regulated in the brain of schizophrenic patients.
Homodimer. Does not require RNA to homodimerize. Able to heterodimerize with BICC1 (By similarity).
The KH domain and the Qua2 region are involved in RNA binding.
References
Application: WB Species: human Sample: PLC-PRF-5 cells
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.