CORO1C Antibody - #DF12586
Product: | CORO1C Antibody |
Catalog: | DF12586 |
Description: | Rabbit polyclonal antibody to CORO1C |
Application: | WB |
Reactivity: | Human, Mouse, Rat |
Prediction: | Pig, Bovine, Horse, Sheep, Rabbit, Dog, Chicken |
Mol.Wt.: | 57 kDa; 53kD(Calculated). |
Uniprot: | Q9ULV4 |
RRID: | AB_2845548 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF12586, RRID:AB_2845548.
Fold/Unfold
COR1C_HUMAN; CORO 1C; Coro1c; Coronin 1c; Coronin actin binding protein 1C; Coronin-1C; Coronin-3; Coronin1c; Coronin3; CRNN 4; CRNN4; HCRNN 4; hCRNN4;
Immunogens
- Q9ULV4 COR1C_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MRRVVRQSKFRHVFGQAVKNDQCYDDIRVSRVTWDSSFCAVNPRFVAIIIEASGGGAFLVLPLHKTGRIDKSYPTVCGHTGPVLDIDWCPHNDQVIASGSEDCTVMVWQIPENGLTLSLTEPVVILEGHSKRVGIVAWHPTARNVLLSAGCDNAIIIWNVGTGEALINLDDMHSDMIYNVSWNRNGSLICTASKDKKVRVIDPRKQEIVAEKEKAHEGARPMRAIFLADGNVFTTGFSRMSERQLALWNPKNMQEPIALHEMDTSNGVLLPFYDPDTSIIYLCGKGDSSIRYFEITDESPYVHYLNTFSSKEPQRGMGYMPKRGLDVNKCEIARFFKLHERKCEPIIMTVPRKSDLFQDDLYPDTAGPEAALEAEEWFEGKNADPILISLKHGYIPGKNRDLKVVKKNILDSKPTANKKCDLISIPKKTTDTASVQNEAKLDEILKEIKSIKDTICNQDERISKLEQQMAKIAA
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q9ULV4 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
K19 | Acetylation | Uniprot | |
R28 | Methylation | Uniprot | |
S187 | Phosphorylation | Uniprot | |
R291 | Methylation | Uniprot | |
Y292 | Phosphorylation | Uniprot | |
S299 | Phosphorylation | Uniprot | |
Y301 | Phosphorylation | Uniprot | |
Y304 | Phosphorylation | Uniprot | |
K311 | Ubiquitination | Uniprot | |
K322 | Ubiquitination | Uniprot | |
K329 | Ubiquitination | Uniprot | |
K337 | Acetylation | Uniprot | |
K353 | Ubiquitination | Uniprot | |
S389 | Phosphorylation | Uniprot | |
K391 | Ubiquitination | Uniprot | |
Y394 | Phosphorylation | Uniprot | |
K398 | Ubiquitination | Uniprot | |
K407 | Ubiquitination | Uniprot | |
K413 | Acetylation | Uniprot | |
K413 | Ubiquitination | Uniprot | |
T415 | Phosphorylation | Uniprot | |
K418 | Acetylation | Uniprot | |
S424 | Phosphorylation | Uniprot | |
T430 | Phosphorylation | Uniprot | |
S434 | Phosphorylation | Uniprot | |
K440 | Acetylation | Uniprot | |
K446 | Acetylation | Uniprot | |
K446 | Ubiquitination | Uniprot | |
S463 | Phosphorylation | P68400 (CSNK2A1) | Uniprot |
K464 | Ubiquitination | Uniprot | |
K471 | Ubiquitination | Uniprot |
Research Backgrounds
Plays a role in directed cell migration by regulating the activation and subcellular location of RAC1. Increases the presence of activated RAC1 at the leading edge of migrating cells. Required for normal organization of the cytoskeleton, including the actin cytoskeleton, microtubules and the vimentin intermediate filaments (By similarity). Plays a role in endoplasmic reticulum-associated endosome fission: localizes to endosome membrane tubules and promotes recruitment of TMCC1, leading to recruitment of the endoplasmic reticulum to endosome tubules for fission. Endosome membrane fission of early and late endosomes is essential to separate regions destined for lysosomal degradation from carriers to be recycled to the plasma membrane. Required for normal cell proliferation, cell migration, and normal formation of lamellipodia (By similarity). Required for normal distribution of mitochondria within cells (By similarity).
Involved in myogenic differentiation.
Cell membrane>Peripheral membrane protein>Cytoplasmic side. Cell projection>Lamellipodium. Cell projection>Ruffle membrane. Cytoplasm>Cytoskeleton. Cytoplasm>Cell cortex. Endosome membrane.
Note: All isoforms colocalize with the actin cytoskeleton in the cytosol, and especially in the cell cortex (PubMed:10828594, PubMed:19651142, PubMed:25074804). Colocalizes with F-actin at the leading edge of lamellipodia. Partially colocalizes with microtubules and vimentin intermediate filaments (PubMed:10828594, PubMed:19651142, PubMed:25074804). Localizes to endosome membrane tubules/buds (PubMed:30220460).
Cell membrane>Sarcolemma. Cytoplasm>Myofibril>Sarcomere. Cell junction>Synapse. Cell membrane>Peripheral membrane protein>Cytoplasmic side. Cytoplasm>Cytoskeleton. Cytoplasm>Cell cortex.
Note: Colocalizes with the thin filaments of the sarcomere and with the postsynaptic area and the junctional sarcoplasm of motor end plates. Colocalizes with the actin cytoskeleton in the cytosol, and especially in the cell cortex.
Ubiquitous.
Binds F-actin. Interacts with RCC2. Interacts preferentially with nucleotide-free and GDP-bound RAC1. Interacts with VIM (via head domain) (By similarity). Isoform 1 and isoform 2 appear as homotrimers, while isoform 3 seems to exist as monomers.
The C-terminal coiled-coil domain is essential for cortical membrane localization and oligomerization.
Belongs to the WD repeat coronin family.
References
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.