xCT Antibody | Affinity Biosciences

Product:	xCT Antibody
Catalog:	DF12509
Description:	Rabbit polyclonal antibody to xCT
Application:	WB IHC IF/ICC
Reactivity:	Human, Mouse, Rat, Monkey
Prediction:	Pig, Horse, Rabbit, Dog
Mol.Wt.:	35~55 kDa; 55kD(Calculated).
Uniprot:	Q9UPY5
RRID:	AB_2845314

View similar products>>

Blocking peptides are peptides that bind specifically to the target antibody and block antibody binding. These peptide usually contains the epitope recognized by the antibody. Antibodies bound to the blocking peptide no longer bind to the epitope on the target protein. By comparing the staining from the blocked antibody versus the antibody alone, one can see which staining is specific.

Size	Price	Inventory
100ul	$280	In stock
200ul	$350	In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Related Downloads

MS Report

HPLC Report

MSDS

Data Sheet

COA

Protocols

WB Handbook

IHC Protocol

IF/ICC Protocol

Product Info

Source:

Rabbit

Application:

WB 1:500-1:2000, IHC 1:50-1:200, IF/ICC 1:100-1:500
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:

Human,Mouse,Rat,Monkey

Prediction:

Pig(93%), Horse(93%), Rabbit(93%), Dog(93%)

Clonality:

Polyclonal

Specificity:

xCT Antibody detects endogenous levels of total xCT.

RRID:

AB_2845314
Cite Format: Affinity Biosciences Cat# DF12509, RRID:AB_2845314.

Conjugate:

Unconjugated.

Purification:

The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).

Storage:

Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.

Alias:

Fold/Unfold

Amino acid transport system xc xCT antibody; Amino acid transport system xc-; Calcium channel blocker resistance protein CCBR1; Calcium channel blocker resistance protein CCBR1 antibody; CCBR1; Cysteine/glutamate transporter antibody; Cystine/glutamate transporter; OTTHUMP00000164578; SLC7A11; Solute carrier family 7 (anionic amino acid transporter light chain, xc- system), member 11; solute carrier family 7; Solute carrier family 7 member 11; Solute carrier family 7, (cationic amino acid transporter, y+ system) member 11; SYSTEM Xc(-) TRANSPORTER-RELATED PROTEIN; xCT; XCT_HUMAN;

Immunogens

Immunogen:

Uniprot:

Q9UPY5(XCT_HUMAN) >>Visit HPA database.

Gene(ID):

SLC7A11(23657)

Sequence:

Q9UPY5 XCT_HUMAN:
Protein BLAST With
NCBI/
ExPASy/
Uniprot

MVRKPVVSTISKGGYLQGNVNGRLPSLGNKEPPGQEKVQLKRKVTLLRGVSIIIGTIIGAGIFISPKGVLQNTGSVGMSLTIWTVCGVLSLFGALSYAELGTTIKKSGGHYTYILEVFGPLPAFVRVWVELLIIRPAATAVISLAFGRYILEPFFIQCEIPELAIKLITAVGITVVMVLNSMSVSWSARIQIFLTFCKLTAILIIIVPGVMQLIKGQTQNFKDAFSGRDSSITRLPLAFYYGMYAYAGWFYLNFVTEEVENPEKTIPLAICISMAIVTIGYVLTNVAYFTTINAEELLLSNAVAVTFSERLLGNFSLAVPIFVALSCFGSMNGGVFAVSRLFYVASREGHLPEILSMIHVRKHTPLPAVIVLHPLTMIMLFSGDLDSLLNFLSFARWLFIGLAVAGLIYLRYKCPDMHRPFKVPLFIPALFSFTCLFMVALSLYSDPFSTGIGFVITLTGVPAYYLFIIWDKKPRWFRIMSEKITRTLQIILEVVPEEDKL

Predictions

Predictions:

Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.

Species

Results

Score

Pig

Horse

Dog

Rabbit

Xenopus

Chicken

Zebrafish

Bovine

Sheep

Model Confidence:
High(score>80) Medium(80>score>50) Low(score<50) No confidence

PTMs - Q9UPY5 As Substrate

Q9UPY5

Site	PTM Type	Source
K4	Ubiquitination	Uniprot
S8	Phosphorylation	Uniprot
T9	Phosphorylation	Uniprot
S11	Phosphorylation	Uniprot
K12	Sumoylation	Uniprot
K12	Ubiquitination	Uniprot
Y15	Phosphorylation	Uniprot
S26	Phosphorylation	Uniprot
K30	Ubiquitination	Uniprot
K37	Ubiquitination	Uniprot
S51	Phosphorylation	Uniprot
K222	Ubiquitination	Uniprot
S481	Phosphorylation	Uniprot
K483	Ubiquitination	Uniprot

Research Backgrounds

Q9UPY5_XCT_HUMAN

Function:

Sodium-independent, high-affinity exchange of anionic amino acids with high specificity for anionic form of cystine and glutamate.

Subcellular Location:

Membrane>Multi-pass membrane protein.

Subunit Structure:

Disulfide-linked heterodimer with the amino acid transport protein SLC3A2/4F2hc.

Family&Domains:

Belongs to the amino acid-polyamine-organocation (APC) superfamily. L-type amino acid transporter (LAT) (TC 2.A.3.8) family.

Research Fields

· Cellular Processes > Cell growth and death > Ferroptosis. (View pathway)

References

1). Biochanin A protects against iron overload associated knee osteoarthritis via regulating iron levels and NRF2/System xc-/GPX4 axis. Biomedicine & Pharmacotherapy, 2023 (PubMed: 36379122) [IF=7.5]

2). Endoplasmic reticulum stress-triggered ferroptosis via the XBP1-Hrd1-Nrf2 pathway induces EMT progression in diabetic nephropathy.. Biomedicine & Pharmacotherapy, 2023 (PubMed: 37224754) [IF=7.5]

Application: WB Species: Mouse Sample: renal tissues

Fig. 4. The characteristic changes of ferroptosis were rescued by TUDCA treatment in DN mice. The qRT-PCR results of SLC7A11 and TFR-1 in each group (n = 3) (A). The WB results of SLC7A11 and TFR-1 among groups (n = 3) (B - C). Immunohistochemistry and quantitative analysis of SLC7A11 and TFR-1 in NC, DN, and TUDCA group (n = 3) (D - E). The content of iron (F), MDA (G), and GSH (H) in renal tissues (n = 6). Data are expressed as the mean ± SEM.

Application: IHC Species: Mouse Sample: renal tissues

3). Allogeneic platelet-rich plasma inhibits ferroptosis in promoting wound repair of type 2 diabetic ulcers. Free radical biology & medicine, 2024 (PubMed: 38408545) [IF=7.4]

4). GSK-3β-dependent Nrf2 antioxidant response modulates ferroptosis of lens epithelial cells in age-related cataract. Free Radical Biology and Medicine, 2023 (PubMed: 37156294) [IF=7.4]

5). YAP1 alleviates sepsis-induced acute lung injury via inhibiting ferritinophagy-mediated ferroptosis. Frontiers in Immunology, 2022 (PubMed: 35979359) [IF=7.3]

6). Zinc oxide nanoparticles induces cell death and consequently leading to incomplete neural tube closure through oxidative stress during embryogenesis. Cell biology and toxicology, 2024 (PubMed: 38958792) [IF=6.1]

7). KLF11 regulates lung adenocarcinoma ferroptosis and chemosensitivity by suppressing GPX4. Communications Biology, 2023 (PubMed: 37248295) [IF=5.9]

Application: WB Species: Human Sample: A549 cells

Fig. 4: Identification of GPX4 as the target molecule of KLF11 to regulate ferroptosis. a Schematic diagram of RNA-seq screening workflow in A549 cell line transfected with KLF11-NC and KLF11-OE. b Volcano plot showing differential expression of genes between the A549-KLF11-NC and KLF11-OE. c Venn plot showing the intersection of predicted targets of KLF11. d, e qRT-PCR results showed differences in RNA levels of three key molecules (GPX4, SLC7A11 and ASCL4) of ferroptosis between the KLF11-NC, KLF11-OE and KLF11-KO of A549 and PC9 cell lines. f, g Western blot results showed differences in protein levels of GPX4, SLC7A11, and ASCL4 of ferroptosis between the KLF11-NC, KLF11-OE, and KLF11-KO of A549 and PC9 cell lines.

8). MNT inhibits lung adenocarcinoma ferroptosis and chemosensitivity by suppressing SAT1. Communications biology, 2024 (PubMed: 38831092) [IF=5.9]

9). Targeted inhibition of CX3CL1 limits podocytes ferroptosis to ameliorate cisplatin-induced acute kidney injury. Molecular medicine (Cambridge, Mass.), 2023 (PubMed: 37875838) [IF=5.7]

Application: WB Species: Mouse Sample: kidney tissues

Fig. 2 CX3CL1 deficiency reduced ferroptosis in renal tissues with cisplatin-induced AKI. A–D RNA sequencing analysis. E–H Measurement of Fe2+, GSH/GSSG ratio, MDA, and SOD levels in kidney tissues. I Expression of ferritin heavy chain in kidney tissues, as measured using western blotting. J Representative images displaying the expression of 3-NT, 4-HNE, and GPX4 as determined by immunohistochemistry. Scale bar = 20 μm. K Western blotting analysis of GPX4 and XCT expression profiles. (AKI, acute kidney injury; GSH/GSSG, glutathione/oxidized glutathione; MDA, malondialdehyde; SOD, superoxide dismutase; 3-NT, 3-nitrotyrosine; 4-HNE, 4-Hydroxynonenal; GPX4, glutathione peroxidase 4; XCT, solute carrier family 7 member 11; P value was calculated by one-way analysis of variance and Tukey’s test.

10). Panax notoginseng Saponins Activate Nuclear Factor Erythroid 2-Related Factor 2 to Inhibit Ferroptosis and Attenuate Inflammatory Injury in Cerebral Ischemia-Reperfusion. The American journal of Chinese medicine, 2024 (PubMed: 38699996) [IF=5.7]

Restrictive clause

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.

xCT Antibody - #DF12509