NudC Antibody - #AF4804
Product: | NudC Antibody |
Catalog: | AF4804 |
Description: | Rabbit polyclonal antibody to NudC |
Application: | WB |
Reactivity: | Human, Mouse, Rat |
Prediction: | Pig, Zebrafish, Bovine, Horse, Sheep, Rabbit, Dog, Chicken, Xenopus |
Mol.Wt.: | 45kDa; 38kD(Calculated). |
Uniprot: | Q9Y266 |
RRID: | AB_2844614 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# AF4804, RRID:AB_2844614.
Fold/Unfold
HNUDC; MNUDC; MNUDC protein; NPD011; Nuclear distribution C homolog; Nuclear distribution gene C (A.nidulans) homolog; Nuclear distribution gene C homolog; Nuclear distribution gene C homolog (A. nidulans); Nuclear distribution protein C homolog; Nuclear migration protein nudC; nudC; NudC nuclear distribution protein; NUDC_HUMAN; OTTHUMP00000004405; SIG 92; SIG92;
Immunogens
Ubiquitous. Highly expressed in fetal liver, kidney, lung and brain. Highly expressed in adult pancreas, kidney, skeletal muscle, liver, lung, placenta, prostate, brain and heart.
- Q9Y266 NUDC_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MGGEQEEERFDGMLLAMAQQHEGGVQELVNTFFSFLRRKTDFFIGGEEGMAEKLITQTFSHHNQLAQKTRREKRARQEAERREKAERAARLAKEAKSETSGPQIKELTDEEAERLQLEIDQKKDAENHEAQLKNGSLDSPGKQDTEEDEEEDEKDKGKLKPNLGNGADLPNYRWTQTLSELDLAVPFCVNFRLKGKDMVVDIQRRHLRVGLKGQPAIIDGELYNEVKVEESSWLIEDGKVVTVHLEKINKMEWWSRLVSSDPEINTKKINPENSKLSDLDSETRSMVEKMMYDQRQKSMGLPTSDEQKKQEILKKFMDQHPEMDFSKAKFN
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q9Y266 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
K39 | Acetylation | Uniprot | |
K39 | Ubiquitination | Uniprot | |
T40 | Phosphorylation | Uniprot | |
K53 | Ubiquitination | Uniprot | |
T58 | Phosphorylation | Uniprot | |
S60 | Phosphorylation | Uniprot | |
K68 | Acetylation | Uniprot | |
K68 | Ubiquitination | Uniprot | |
K93 | Acetylation | Uniprot | |
K96 | Sumoylation | Uniprot | |
K96 | Ubiquitination | Uniprot | |
T99 | Phosphorylation | Uniprot | |
S100 | Phosphorylation | Uniprot | |
K105 | Ubiquitination | Uniprot | |
T108 | Phosphorylation | Uniprot | |
K122 | Ubiquitination | Uniprot | |
K133 | Ubiquitination | Uniprot | |
S136 | Phosphorylation | P24941 (CDK2) | Uniprot |
S139 | Phosphorylation | P24941 (CDK2) | Uniprot |
T145 | Phosphorylation | Uniprot | |
K196 | Acetylation | Uniprot | |
K196 | Ubiquitination | Uniprot | |
K212 | Ubiquitination | Uniprot | |
Y223 | Phosphorylation | Uniprot | |
K239 | Acetylation | Uniprot | |
K250 | Ubiquitination | Uniprot | |
S259 | Phosphorylation | Uniprot | |
S260 | Phosphorylation | Uniprot | |
T266 | Phosphorylation | Uniprot | |
K267 | Acetylation | Uniprot | |
K267 | Ubiquitination | Uniprot | |
K268 | Ubiquitination | Uniprot | |
S274 | Phosphorylation | P53350 (PLK1) | Uniprot |
K275 | Ubiquitination | Uniprot | |
S277 | Phosphorylation | Uniprot | |
S281 | Phosphorylation | Uniprot | |
S285 | Phosphorylation | Uniprot | |
K289 | Ubiquitination | Uniprot | |
Y292 | Phosphorylation | Uniprot | |
K297 | Ubiquitination | Uniprot | |
S298 | Phosphorylation | Uniprot | |
S304 | Phosphorylation | Uniprot | |
K308 | Ubiquitination | Uniprot | |
K315 | Ubiquitination | Uniprot | |
S326 | Phosphorylation | P53350 (PLK1) | Uniprot |
K327 | Methylation | Uniprot | |
K327 | Ubiquitination | Uniprot | |
K329 | Methylation | Uniprot |
Research Backgrounds
Plays a role in neurogenesis and neuronal migration (By similarity). Necessary for correct formation of mitotic spindles and chromosome separation during mitosis. Necessary for cytokinesis and cell proliferation.
Reversibly phosphorylated on serine residues during the M phase of the cell cycle. Phosphorylation on Ser-274 and Ser-326 is necessary for correct formation of mitotic spindles and chromosome separation during mitosis. Phosphorylated by PLK and other kinases.
Cytoplasm>Cytoskeleton. Nucleus.
Note: In a filamentous pattern adjacent to the nucleus of migrating cerebellar granule cells. Colocalizes with tubulin and dynein and with the microtubule organizing center. Distributed throughout the cytoplasm of non-migrating cells. A small proportion is nuclear, in a punctate pattern.
Ubiquitous. Highly expressed in fetal liver, kidney, lung and brain. Highly expressed in adult pancreas, kidney, skeletal muscle, liver, lung, placenta, prostate, brain and heart.
Interacts with PAFAH1B1 (By similarity). Interacts with PLK1. Part of a complex containing PLK1, NUDC, dynein and dynactin. Interacts with DCDC1.
Belongs to the nudC family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.