Phospho-DAPP1/BAM32 (Tyr139) Antibody - #AF4502
Product: | Phospho-DAPP1/BAM32 (Tyr139) Antibody |
Catalog: | AF4502 |
Description: | Rabbit polyclonal antibody to Phospho-DAPP1/BAM32 (Tyr139) |
Application: | WB IHC |
Reactivity: | Human, Rat |
Prediction: | Pig, Zebrafish, Bovine, Horse, Sheep, Rabbit, Dog, Chicken, Xenopus |
Mol.Wt.: | 29kDa; 32kD(Calculated). |
Uniprot: | Q9UN19 |
RRID: | AB_2844553 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# AF4502, RRID:AB_2844553.
Fold/Unfold
B cell adapter molecule of 32 kDa; B lymphocyte adapter protein Bam32; B-cell adapter molecule of 32 kDa; BAM32; DAPP1; DAPP1_HUMAN; DKFZp667E0716; Dual adapter for phosphotyrosine and 3-phosphotyrosine and 3-phosphoinositide; Dual adaptor of phosphotyrosine and 3 phosphoinositides; hDAPP1;
Immunogens
Highly expressed in placenta and lung, followed by brain, heart, kidney, liver, pancreas and skeletal muscle. Expressed by B-lymphocytes, but not T-lymphocytes or nonhematopoietic cells.
- Q9UN19 DAPP1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MGRAELLEGKMSTQDPSDLWSRSDGEAELLQDLGWYHGNLTRHAAEALLLSNGCDGSYLLRDSNETTGLYSLSVRAKDSVKHFHVEYTGYSFKFGFNEFSSLKDFVKHFANQPLIGSETGTLMVLKHPYPRKVEEPSIYESVRVHTAMQTGRTEDDLVPTAPSLGTKEGYLTKQGGLVKTWKTRWFTLHRNELKYFKDQMSPEPIRILDLTECSAVQFDYSQERVNCFCLVFPFRTFYLCAKTGVEADEWIKILRWKLSQIRKQLNQGEGTIRSRSFIFK
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q9UN19 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
K132 | Ubiquitination | Uniprot | |
S137 | Phosphorylation | Uniprot | |
Y139 | Phosphorylation | P06239 (LCK) , P07948 (LYN) , P12931 (SRC) | Uniprot |
S141 | Phosphorylation | Uniprot | |
K167 | Ubiquitination | Uniprot | |
K173 | Ubiquitination | Uniprot | |
K182 | Acetylation | Uniprot | |
K263 | Ubiquitination | Uniprot | |
S274 | Phosphorylation | Uniprot | |
S276 | Phosphorylation | Uniprot |
Research Backgrounds
May act as a B-cell-associated adapter that regulates B-cell antigen receptor (BCR)-signaling downstream of PI3K.
Phosphorylated on tyrosine residues.
Cytoplasm. Membrane>Peripheral membrane protein.
Note: Membrane-associated after cell stimulation leading to its translocation.
Highly expressed in placenta and lung, followed by brain, heart, kidney, liver, pancreas and skeletal muscle. Expressed by B-lymphocytes, but not T-lymphocytes or nonhematopoietic cells.
Interacts with PtdIns(3,4,5)P3 and PLCG2. In vitro, interacts with PtdIns(3,4)P2.
Research Fields
· Organismal Systems > Immune system > B cell receptor signaling pathway. (View pathway)
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.