Phospho-RAD52 (Tyr104) Antibody - #AF4431
Product: | Phospho-RAD52 (Tyr104) Antibody |
Catalog: | AF4431 |
Description: | Rabbit polyclonal antibody to Phospho-RAD52 (Tyr104) |
Application: | WB |
Reactivity: | Human, Mouse |
Prediction: | Pig, Zebrafish, Bovine, Horse, Sheep, Rabbit, Dog, Chicken, Xenopus |
Mol.Wt.: | 46kDa; 46kD(Calculated). |
Uniprot: | P43351 |
RRID: | AB_2844495 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# AF4431, RRID:AB_2844495.
Fold/Unfold
DNA repair protein RAD52; DNA repair protein RAD52; DNA repair protein RAD52 homolog; RAD 52; Rad52; RAD52 homolog (S. cerevisiae); RAD52 homolog (S. cerevisiae); RAD52 homolog; RAD52_HUMAN; Recombination protein RAD52; Recombination protein RAD52; Rhabdomyosarcoma antigen MU RMS 40.23;
Immunogens
- P43351 RAD52_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MSGTEEAILGGRDSHPAAGGGSVLCFGQCQYTAEEYQAIQKALRQRLGPEYISSRMAGGGQKVCYIEGHRVINLANEMFGYNGWAHSITQQNVDFVDLNNGKFYVGVCAFVRVQLKDGSYHEDVGYGVSEGLKSKALSLEKARKEAVTDGLKRALRSFGNALGNCILDKDYLRSLNKLPRQLPLEVDLTKAKRQDLEPSVEEARYNSCRPNMALGHPQLQQVTSPSRPSHAVIPADQDCSSRSLSSSAVESEATHQRKLRQKQLQQQFRERMEKQQVRVSTPSAEKSEAAPPAPPVTHSTPVTVSEPLLEKDFLAGVTQELIKTLEDNSEKWAVTPDAGDGVVKPSSRADPAQTSDTLALNNQMVTQNRTPHSVCHQKPQAKSGSWDLQTYSADQRTTGNWESHRKSQDMKKRKYDPS
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - P43351 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
S2 | Phosphorylation | Uniprot | |
K41 | Ubiquitination | Uniprot | |
Y104 | Phosphorylation | P00519 (ABL1) , A0A173G4P4 (Abl fusion) , A9UF07 (BCR/ABL fusion) | Uniprot |
S129 | Phosphorylation | Uniprot | |
K133 | Acetylation | Uniprot | |
K135 | Ubiquitination | Uniprot | |
S138 | Phosphorylation | Uniprot | |
K141 | Ubiquitination | Uniprot | |
Y171 | Phosphorylation | Uniprot | |
S174 | Phosphorylation | Uniprot | |
K177 | Acetylation | Uniprot | |
K177 | Ubiquitination | Uniprot | |
K190 | Acetylation | Uniprot | |
K192 | Acetylation | Uniprot | |
S199 | Phosphorylation | Uniprot | |
Y205 | Phosphorylation | Uniprot | |
S207 | Phosphorylation | Uniprot | |
T223 | Phosphorylation | Uniprot | |
S224 | Phosphorylation | Uniprot | |
S251 | Phosphorylation | Uniprot | |
K262 | Acetylation | Uniprot | |
K274 | Acetylation | Uniprot | |
T281 | Phosphorylation | Uniprot | |
K286 | Acetylation | Uniprot | |
S287 | Phosphorylation | Uniprot | |
S299 | Phosphorylation | Uniprot | |
T303 | Phosphorylation | Uniprot | |
T318 | Phosphorylation | Uniprot | |
K323 | Acetylation | Uniprot | |
T335 | Phosphorylation | Uniprot | |
K344 | Acetylation | Uniprot | |
T397 | Phosphorylation | Uniprot | |
K406 | Acetylation | Uniprot | |
K411 | Sumoylation | Uniprot | |
K412 | Acetylation | Uniprot | |
K412 | Sumoylation | Uniprot | |
K414 | Acetylation | Uniprot | |
K414 | Sumoylation | Uniprot |
Research Backgrounds
Involved in double-stranded break repair. Plays a central role in genetic recombination and DNA repair by promoting the annealing of complementary single-stranded DNA and by stimulation of the RAD51 recombinase.
Phosphorylated upon DNA damage by ABL1, and probably by ATM or ATR.
Nucleus.
The full-length protein forms heptameric rings. Interacts with ABL1. Interacts with RPA2; the interaction is direct and associates RAD52 with the RPA complex.
Belongs to the RAD52 family.
Research Fields
· Genetic Information Processing > Replication and repair > Homologous recombination.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.