Phospho-PPP1R8/ARD1 (Ser199) Antibody - #AF4334
Product: | Phospho-PPP1R8/ARD1 (Ser199) Antibody |
Catalog: | AF4334 |
Description: | Rabbit polyclonal antibody to Phospho-PPP1R8/ARD1 (Ser199) |
Application: | WB |
Reactivity: | Human, Mouse, Rat |
Prediction: | Pig, Bovine, Horse, Sheep, Rabbit, Dog, Chicken, Xenopus |
Mol.Wt.: | 28kDa; 38kD(Calculated). |
Uniprot: | Q12972 |
RRID: | AB_2844413 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# AF4334, RRID:AB_2844413.
Fold/Unfold
Activator of RNA decay; ARD 1; ARD-1; ARD1; Homolog of E.coli RNase E; NIPP 1; NIPP-1; NIPP1; Nuclear inhibitor of protein phosphatase 1; nuclear inhibitor of protein phosphatase-1 alpha; Nuclear subunit of PP1; PP1R8_HUMAN; PPP1R8; PRO2047; Protein phosphatase 1 regulatory inhibitor subunit 8; Protein phosphatase 1 regulatory subunit 8; RNase E; RNase E, E. coli, homolog of;
Immunogens
Ubiquitously expressed, with highest levels in heart and skeletal muscle, followed by brain, placenta, lung, liver and pancreas. Less abundant in kidney. The concentration and ratio between isoforms is cell-type dependent. Isoform Alpha (>90%) and isoform Beta were found in brain, heart and kidney. Isoform Gamma is mainly found in B-cells and T-lymphocytes, and has been found in 293 embryonic kidney cells.
- Q12972 PP1R8_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MAAAANSGSSLPLFDCPTWAGKPPPGLHLDVVKGDKLIEKLIIDEKKYYLFGRNPDLCDFTIDHQSCSRVHAALVYHKHLKRVFLIDLNSTHGTFLGHIRLEPHKPQQIPIDSTVSFGASTRAYTLREKPQTLPSAVKGDEKMGGEDDELKGLLGLPEEETELDNLTEFNTAHNKRISTLTIEEGNLDIQRPKRKRKNSRVTFSEDDEIINPEDVDPSVGRFRNMVQTAVVPVKKKRVEGPGSLGLEESGSRRMQNFAFSGGLYGGLPPTHSEAGSQPHGIHGTALIGGLPMPYPNLAPDVDLTPVVPSAVNMNPAPNPAVYNPEAVNEPKKKKYAKEAWPGKKPTPSLLI
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q12972 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
S120 | Phosphorylation | Uniprot | |
T121 | Phosphorylation | Uniprot | |
T161 | Phosphorylation | Uniprot | |
K175 | Ubiquitination | Uniprot | |
S178 | Phosphorylation | Uniprot | |
K193 | Sumoylation | Uniprot | |
S199 | Phosphorylation | Uniprot | |
T202 | Phosphorylation | Uniprot | |
S204 | Phosphorylation | Uniprot | |
K236 | Methylation | Uniprot | |
S249 | Phosphorylation | Uniprot | |
Y264 | Phosphorylation | P07948 (LYN) | Uniprot |
Y335 | Phosphorylation | P07948 (LYN) | Uniprot |
T346 | Phosphorylation | Uniprot |
Research Backgrounds
Inhibitor subunit of the major nuclear protein phosphatase-1 (PP-1). It has RNA-binding activity but does not cleave RNA and may target PP-1 to RNA-associated substrates. May also be involved in pre-mRNA splicing. Binds DNA and might act as a transcriptional repressor. Seems to be required for cell proliferation.
Isoform Gamma is a site-specific single-strand endoribonuclease that cleaves single strand RNA 3' to purines and pyrimidines in A+U-rich regions. It generates 5'-phosphate termini at the site of cleavage. This isoform does not inhibit PP-1. May be implicated in mRNA splicing.
May be inactivated by phosphorylation on Ser-199 or Ser-204 (By similarity). Phosphorylated by Lyn in vitro on Tyr-264, and also on Tyr-335 in the presence of RNA.
Nucleus. Nucleus speckle.
Note: Primarily, but not exclusively, nuclear.
Cytoplasm.
Note: Found mainly in the cytoplasm.
Ubiquitously expressed, with highest levels in heart and skeletal muscle, followed by brain, placenta, lung, liver and pancreas. Less abundant in kidney. The concentration and ratio between isoforms is cell-type dependent. Isoform Alpha (>90%) and isoform Beta were found in brain, heart and kidney. Isoform Gamma is mainly found in B-cells and T-lymphocytes, and has been found in 293 embryonic kidney cells.
Interacts with phosphorylated CDC5L, SF3B1 and MELK. Interacts with EED, in a nucleic acid-stimulated manner. Part of a complex consisting of PPP1R8, EED, HDAC2 and PP-1. Part of the spliceosome. Interacts with PPP1CA, PPP1CB and PPP1CC.
Has a basic N- and C-terminal and an acidic central domain.
The FHA domain mediates interactions with threonine-phosphorylated MELK.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.