Phospho-osterix (Thr319) Antibody - #AF7080
Product: | Phospho-osterix (Thr319) Antibody |
Catalog: | AF7080 |
Description: | Rabbit polyclonal antibody to Phospho-osterix (Thr319) |
Application: | WB IF/ICC |
Reactivity: | Human, Mouse, Rat |
Prediction: | Pig, Zebrafish, Bovine, Horse, Rabbit, Dog, Xenopus |
Mol.Wt.: | 46kDa; 45kD(Calculated). |
Uniprot: | Q8TDD2 |
RRID: | AB_2843520 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# AF7080, RRID:AB_2843520.
Fold/Unfold
MGC126598; Osterix; Osx; Sp 7; SP7; Sp7 transcription factor; SP7_HUMAN; Transcription factor Sp7; Zinc finger protein osterix;
Immunogens
- Q8TDD2 SP7_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MASSLLEEEVHYGSSPLAMLTAACSKFGGSSPLRDSTTLGKAGTKKPYSVGSDLSASKTMGDAYPAPFTSTNGLLSPAGSPPAPTSGYANDYPPFSHSFPGPTGTQDPGLLVPKGHSSSDCLPSVYTSLDMTHPYGSWYKAGIHAGISPGPGNTPTPWWDMHPGGNWLGGGQGQGDGLQGTLPTGPAQPPLNPQLPTYPSDFAPLNPAPYPAPHLLQPGPQHVLPQDVYKPKAVGNSGQLEGSGGAKPPRGASTGGSGGYGGSGAGRSSCDCPNCQELERLGAAAAGLRKKPIHSCHIPGCGKVYGKASHLKAHLRWHTGERPFVCNWLFCGKRFTRSDELERHVRTHTREKKFTCLLCSKRFTRSDHLSKHQRTHGEPGPGPPPSGPKELGEGRSTGEEEASQTPRPSASPATPEKAPGGSPEQSNLLEI
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q8TDD2 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
S30 | Phosphorylation | Uniprot | |
S31 | Phosphorylation | Uniprot | |
T37 | Phosphorylation | Uniprot | |
T38 | Phosphorylation | Uniprot | |
K41 | Ubiquitination | Uniprot | |
S49 | Phosphorylation | Uniprot | |
S52 | Phosphorylation | Uniprot | |
K58 | Ubiquitination | Uniprot | |
S76 | Phosphorylation | Q16539 (MAPK14) | Uniprot |
S80 | Phosphorylation | Q16539 (MAPK14) | Uniprot |
K230 | Ubiquitination | Uniprot | |
S237 | Phosphorylation | Uniprot | |
K307 | Acetylation | Uniprot | |
K312 | Acetylation | Uniprot | |
T319 | Phosphorylation | Uniprot | |
S338 | Phosphorylation | Uniprot | |
T364 | Phosphorylation | Uniprot | |
S366 | Phosphorylation | Uniprot | |
S370 | Phosphorylation | Uniprot | |
S396 | Phosphorylation | Uniprot | |
T397 | Phosphorylation | Uniprot | |
S422 | Phosphorylation | Uniprot |
Research Backgrounds
Transcriptional activator essential for osteoblast differentiation. Binds to SP1 and EKLF consensus sequences and to other G/C-rich sequences (By similarity).
Transcriptional activator essential for osteoblast differentiation. Binds to SP1 and EKLF consensus sequences and to other G/C-rich sequences.
Ubiquitination at leads to proteasomal degradation. SP7 is a short-live protein with an endogenous half-life of approximately 12 hours.
Propionylated. Depropionylation at Lys-371 by SIRT7 activates transcription factor activity and positively regulates bone formation by osteoblasts.
Nucleus.
Restricted to bone-derived cell.
Interacts with RIOX1; the interaction is direct and inhibits transcription activator activity.
The 9aaTAD motif is a transactivation domain present in a large number of yeast and animal transcription factors.
Belongs to the Sp1 C2H2-type zinc-finger protein family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.