Rab 34 Antibody - #AF9174
Product: | Rab 34 Antibody |
Catalog: | AF9174 |
Description: | Rabbit polyclonal antibody to Rab 34 |
Application: | WB IHC IF/ICC |
Reactivity: | Human, Rat |
Prediction: | Pig, Bovine, Horse, Sheep, Rabbit, Dog, Chicken, Xenopus |
Mol.Wt.: | 29kDa; 29kD(Calculated). |
Uniprot: | Q9BZG1 |
RRID: | AB_2843364 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# AF9174, RRID:AB_2843364.
Fold/Unfold
Rab-39; RAB34; RAB34, member RAS oncogene family; RAB34_HUMAN; RAB39; RAH; Ras-related protein Rab-34; Ras-related protein Rab-39; Ras-related protein Rah;
Immunogens
- Q9BZG1 RAB34_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MNILAPVRRDRVLAELPQCLRKEAALHGHKDFHPRVTCACQEHRTGTVGFKISKVIVVGDLSVGKTCLINRFCKDTFDKNYKATIGVDFEMERFEVLGIPFSLQLWDTAGQERFKCIASTYYRGAQAIIIVFNLNDVASLEHTKQWLADALKENDPSSVLLFLVGSKKDLSTPAQYALMEKDALQVAQEMKAEYWAVSSLTGENVREFFFRVAALTFEANVLAELEKSGARRIGDVVRINSDDSNLYLTASKKKPTCCP
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q9BZG1 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
M1 | Acetylation | Uniprot | |
K22 | Ubiquitination | Uniprot | |
K30 | Ubiquitination | Uniprot | |
K51 | Ubiquitination | Uniprot | |
S62 | Phosphorylation | Uniprot | |
K74 | Ubiquitination | Uniprot | |
T76 | Phosphorylation | Uniprot | |
K79 | Ubiquitination | Uniprot | |
Y81 | Phosphorylation | Uniprot | |
T108 | Phosphorylation | Uniprot | |
K168 | Ubiquitination | Uniprot | |
K181 | Ubiquitination | Uniprot | |
S241 | Phosphorylation | Uniprot | |
S244 | Phosphorylation | Uniprot | |
Y247 | Phosphorylation | Uniprot | |
K252 | Ubiquitination | Uniprot |
Research Backgrounds
Protein transport. Involved in the redistribution of lysosomes to the peri-Golgi region (By similarity). Plays a role in the maturation of phagosomes that engulf pathogens, such as S.aureus and M.tuberculosis. Plays a role in the fusion of phagosomes with lysosomes. Acts also as a positive regulator of hedgehog signaling and regulates ciliary function (By similarity).
Cytoplasm. Golgi apparatus. Cytoplasmic vesicle>Phagosome. Cytoplasmic vesicle>Phagosome membrane>Lipid-anchor>Cytoplasmic side. Cell projection>Cilium.
Note: Recruited to phagosomes containing S.aureus or M.tuberculosis (PubMed:21255211).
Interacts with RILP.
Belongs to the small GTPase superfamily. Rab family.
References
Application: IHC Species: Human Sample: HCT16 cells and SW480 cells
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.