PIG3 Antibody - #AF9159
Product: | PIG3 Antibody |
Catalog: | AF9159 |
Description: | Rabbit polyclonal antibody to PIG3 |
Application: | WB IHC IF/ICC |
Reactivity: | Human, Mouse |
Prediction: | Bovine, Horse, Sheep |
Mol.Wt.: | 36kDa; 36kD(Calculated). |
Uniprot: | Q53FA7 |
RRID: | AB_2843349 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# AF9159, RRID:AB_2843349.
Fold/Unfold
p53 induced gene 3 protein; p53-induced gene 3 protein; Putative quinone oxidoreductase; QORX_HUMAN; quinone oxidoreductase homolog; Quinone oxidoreductase PIG3; TP53I3; Tumor protein p53 inducible protein 3; Tumor protein p53-inducible protein 3;
Immunogens
- Q53FA7 QORX_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MLAVHFDKPGGPENLYVKEVAKPSPGEGEVLLKVAASALNRADLMQRQGQYDPPPGASNILGLEASGHVAELGPGCQGHWKIGDTAMALLPGGGQAQYVTVPEGLLMPIPEGLTLTQAAAIPEAWLTAFQLLHLVGNVQAGDYVLIHAGLSGVGTAAIQLTRMAGAIPLVTAGSQKKLQMAEKLGAAAGFNYKKEDFSEATLKFTKGAGVNLILDCIGGSYWEKNVNCLALDGRWVLYGLMGGGDINGPLFSKLLFKRGSLITSLLRSRDNKYKQMLVNAFTEQILPHFSTEGPQRLLPVLDRIYPVTEIQEAHKYMEANKNIGKIVLELPQ
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q53FA7 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
T85 | Phosphorylation | Uniprot | |
T100 | Phosphorylation | Uniprot | |
K194 | Ubiquitination | Uniprot | |
K203 | Ubiquitination | Uniprot | |
S260 | Phosphorylation | Uniprot | |
T263 | Phosphorylation | Uniprot | |
S264 | Phosphorylation | Uniprot | |
K321 | Acetylation | Uniprot |
Research Backgrounds
May be involved in the generation of reactive oxygen species (ROS). Has low NADPH-dependent beta-naphthoquinone reductase activity, with a preference for 1,2-beta-naphthoquinone over 1,4-beta-naphthoquinone. Has low NADPH-dependent diamine reductase activity (in vitro).
Homodimer.
Belongs to the zinc-containing alcohol dehydrogenase family. Quinone oxidoreductase subfamily.
Research Fields
· Cellular Processes > Cell growth and death > p53 signaling pathway. (View pathway)
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.