MRGF Antibody - #AF9117
Product: | MRGF Antibody |
Catalog: | AF9117 |
Description: | Rabbit polyclonal antibody to MRGF |
Application: | WB IHC IF/ICC |
Reactivity: | Human |
Prediction: | Pig, Bovine, Horse, Sheep, Dog |
Mol.Wt.: | 40kDa; 38kD(Calculated). |
Uniprot: | Q96AM1 |
RRID: | AB_2843307 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# AF9117, RRID:AB_2843307.
Fold/Unfold
DKFZp586B2122; FLJ16111; FLJ29034; FLJ40998; FLJ53714; G protein coupled receptor 140; G protein coupled receptor 168; G protein coupled receptor MrgF; G-protein coupled receptor 140; G-protein coupled receptor 168; GPR140; GPR168; Mas related G protein coupled MRGF; Mas related G protein coupled receptor member F; Mas related gene F protein; MAS related GPR member F; Mas-related G-protein coupled receptor member F; Mas-related gene F protein; MGC21621; MRGF; Mrgprf; MRGRF_HUMAN; RTA; Seven transmembrane helix receptor;
Immunogens
- Q96AM1 MRGRF_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MAGNCSWEAHPGNRNKMCPGLSEAPELYSRGFLTIEQIAMLPPPAVMNYIFLLLCLCGLVGNGLVLWFFGFSIKRNPFSIYFLHLASADVGYLFSKAVFSILNTGGFLGTFADYIRSVCRVLGLCMFLTGVSLLPAVSAERCASVIFPAWYWRRRPKRLSAVVCALLWVLSLLVTCLHNYFCVFLGRGAPGAACRHMDIFLGILLFLLCCPLMVLPCLALILHVECRARRRQRSAKLNHVILAMVSVFLVSSIYLGIDWFLFWVFQIPAPFPEYVTDLCICINSSAKPIVYFLAGRDKSQRLWEPLRVVFQRALRDGAELGEAGGSTPNTVTMEMQCPPGNAS
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q96AM1 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
S117 | Phosphorylation | Uniprot | |
S299 | Phosphorylation | Uniprot |
Research Backgrounds
Orphan receptor. May bind to a neuropeptide and may regulate nociceptor function and/or development, including the sensation or modulation of pain (By similarity).
Cell membrane>Multi-pass membrane protein.
Belongs to the G-protein coupled receptor 1 family. Mas subfamily.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.