HoxD10 Antibody - #AF9089
Product: | HoxD10 Antibody |
Catalog: | AF9089 |
Description: | Rabbit polyclonal antibody to HoxD10 |
Application: | WB IF/ICC |
Reactivity: | Human |
Prediction: | Pig, Bovine, Horse, Sheep, Rabbit |
Mol.Wt.: | 32kDa; 38kD(Calculated). |
Uniprot: | P28358 |
RRID: | AB_2843280 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# AF9089, RRID:AB_2843280.
Fold/Unfold
AI385591; AI874987; Homeo box 4D; Homeo box D10; Homeobox D10; Homeobox protein Hox-4D; Homeobox protein Hox-4E; Homeobox protein Hox-D10; Hox 4.4; Hox 4.5; Hox 4D; Hox 4E; Hox 5.3; HOX4D; HOX4E; HOXD10; HXD10; HXD10_HUMAN; OTTMUSP00000017845; RP23-313J15.9;
Immunogens
- P28358 HXD10_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MSFPNSSPAANTFLVDSLISACRSDSFYSSSASMYMPPPSADMGTYGMQTCGLLPSLAKREVNHQNMGMNVHPYIPQVDSWTDPNRSCRIEQPVTQQVPTCSFTTNIKEESNCCMYSDKRNKLISAEVPSYQRLVPESCPVENPEVPVPGYFRLSQTYATGKTQEYNNSPEGSSTVMLQLNPRGAAKPQLSAAQLQMEKKMNEPVSGQEPTKVSQVESPEAKGGLPEERSCLAEVSVSSPEVQEKESKEEIKSDTPTSNWLTAKSGRKKRCPYTKHQTLELEKEFLFNMYLTRERRLEISKSVNLTDRQVKIWFQNRRMKLKKMSRENRIRELTANLTFS
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - P28358 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
K59 | Acetylation | Uniprot | |
S87 | Phosphorylation | Uniprot | |
T95 | Phosphorylation | Uniprot | |
S218 | Phosphorylation | Uniprot | |
S238 | Phosphorylation | Uniprot | |
S239 | Phosphorylation | Uniprot | |
K269 | Ubiquitination | Uniprot | |
K275 | Ubiquitination | Uniprot |
Research Backgrounds
Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis.
Nucleus.
Strongly expressed in the adult male and female urogenital tracts.
Belongs to the Abd-B homeobox family.
Research Fields
· Human Diseases > Cancers: Overview > Proteoglycans in cancer.
· Human Diseases > Cancers: Overview > MicroRNAs in cancer.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.