Granzyme H Antibody - #AF9078
Product: | Granzyme H Antibody |
Catalog: | AF9078 |
Description: | Rabbit polyclonal antibody to Granzyme H |
Application: | WB IHC IF/ICC |
Reactivity: | Human, Mouse |
Prediction: | Pig, Rabbit |
Mol.Wt.: | 23kDa; 27kD(Calculated). |
Uniprot: | P20718 |
RRID: | AB_2843269 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# AF9078, RRID:AB_2843269.
Fold/Unfold
Cathepsin G like 2; Cathepsin G-like 2; CCP X; CCP-X; CGL 2; CGL2; CSP C; CSP-C; CTLA1; CTSGL2; Cytotoxic serine protease C; Cytotoxic T lymphocyte associated serine esterase 1; Cytotoxic T lymphocyte proteinase; Cytotoxic T-lymphocyte proteinase; EC 3.4.21.-; GRAH_HUMAN; Granzyme H (cathepsin G-like 2, protein h-CCPX); Granzyme H; GZMH; Protein h CCPX;
Immunogens
- P20718 GRAH_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MQPFLLLLAFLLTPGAGTEEIIGGHEAKPHSRPYMAFVQFLQEKSRKRCGGILVRKDFVLTAAHCQGSSINVTLGAHNIKEQERTQQFIPVKRPIPHPAYNPKNFSNDIMLLQLERKAKWTTAVRPLRLPSSKAQVKPGQLCSVAGWGYVSMSTLATTLQEVLLTVQKDCQCERLFHGNYSRATEICVGDPKKTQTGFKGDSGGPLVCKDVAQGILSYGNKKGTPPGVYIKVSHFLPWIKRTMKRL
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
Cytotoxic chymotrypsin-like serine protease with preference for bulky and aromatic residues at the P1 position and acidic residues at the P3' and P4' sites. Probably necessary for target cell lysis in cell-mediated immune responses. Participates in the antiviral response via direct cleavage of several proteins essential for viral replication.
Cytoplasmic granule.
Note: Cytoplasmic granules of cytolytic T-lymphocytes.
Constitutively expressed in NK cells.
Belongs to the peptidase S1 family. Granzyme subfamily.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.