MSX1/2 Antibody - #DF8799
Product: | MSX1/2 Antibody |
Catalog: | DF8799 |
Description: | Rabbit polyclonal antibody to MSX1/2 |
Application: | WB IF/ICC |
Reactivity: | Human, Mouse, Rat |
Prediction: | Pig, Bovine, Horse, Dog, Chicken, Xenopus |
Mol.Wt.: | 31 kDa,29kDa; 31kD,29kD(Calculated). |
Uniprot: | P28360 | P35548 |
RRID: | AB_2841997 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF8799, RRID:AB_2841997.
Fold/Unfold
AA675338; AI324650; Homeobox 7; Homeobox protein Hox-7; Homeobox protein MSX 1; Homeobox protein MSX-1; Homeobox protein MSX1; Homeobox, msh like 1; Homeobox, msh-like 1; HOX 7; Hox 7.1; Hox-7; HOX7; Hox7.1; HYD 1; HYD1; msh (Drosophila) homeo box homolog 1 (formerly homeo box 7); Msh; msh homeo box 1; msh homeo box homolog 1; Msh homeobox 1; Msh homeobox 1 like protein; Msh homeobox 1-like protein; msh homeobox homolog 1 (Drosophila); msh homeobox homolog 1; MSH, Drosophila, Homolog of, 1; MSX 1; MSX1; MSX1_HUMAN; Muscle segment homeobox; Muscle segment homeobox, Drosophila, Homolog of, 1; OFC5; OTTHUMP00000115387; STHAG1; CRS 2; CRS2; FPP; Homeo box msh like 2; Homeobox protein Hox-8; Homeobox protein MSX 2; Homeobox protein MSX-2; Homeobox protein MSX2; Hox 8; Hox8; MSH; Msh homeo box 2; Msh homeo box homolog; Msh homeo box homolog 2; Msh homeobox 2; Msh homeobox homolog 2; Msx 2; MSX2; MSX2_HUMAN; Parietal foramina 1; PFM 1; PFM; PFM1;
Immunogens
- P28360 MSX1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MAPAADMTSLPLGVKVEDSAFGKPAGGGAGQAPSAAAATAAAMGADEEGAKPKVSPSLLPFSVEALMADHRKPGAKESALAPSEGVQAAGGSAQPLGVPPGSLGAPDAPSSPRPLGHFSVGGLLKLPEDALVKAESPEKPERTPWMQSPRFSPPPARRLSPPACTLRKHKTNRKPRTPFTTAQLLALERKFRQKQYLSIAERAEFSSSLSLTETQVKIWFQNRRAKAKRLQEAELEKLKMAAKPMLPPAAFGLSFPLGGPAAVAAAAGASLYGASGPFQRAALPVAPVGLYTAHVGYSMYHLT
- P35548 MSX2_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MASPSKGNDLFSPDEEGPAVVAGPGPGPGGAEGAAEERRVKVSSLPFSVEALMSDKKPPKEASPLPAESASAGATLRPLLLSGHGAREAHSPGPLVKPFETASVKSENSEDGAAWMQEPGRYSPPPRHMSPTTCTLRKHKTNRKPRTPFTTSQLLALERKFRQKQYLSIAERAEFSSSLNLTETQVKIWFQNRRAKAKRLQEAELEKLKMAAKPMLPSSFSLPFPISSPLQAASIYGASYPFHRPVLPIPPVGLYATPVGYGMYHLS
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - P28360/P35548 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
S63 | Phosphorylation | Uniprot | |
S91 | Phosphorylation | Uniprot | |
Y122 | Phosphorylation | Uniprot | |
S123 | Phosphorylation | Uniprot | |
S130 | Phosphorylation | Uniprot | |
T135 | Phosphorylation | P05771 (PRKCB) | Uniprot |
T141 | Phosphorylation | P05771 (PRKCB) | Uniprot |
K160 | Acetylation | Uniprot | |
K164 | Acetylation | Uniprot | |
K207 | Ubiquitination | Uniprot |
Site | PTM Type | Enzyme | Source |
---|---|---|---|
S136 | Phosphorylation | Uniprot | |
S148 | Phosphorylation | Uniprot | |
S152 | Phosphorylation | Uniprot | |
S160 | Phosphorylation | Uniprot | |
T180 | Phosphorylation | Uniprot | |
K237 | Ubiquitination | Uniprot |
Research Backgrounds
Acts as a transcriptional repressor. May play a role in limb-pattern formation. Acts in cranofacial development and specifically in odontogenesis. Expression in the developing nail bed mesenchyme is important for nail plate thickness and integrity.
Sumoylated by PIAS1, desumoylated by SENP1.
Nucleus.
Expressed in the developing nail bed mesenchyme.
Belongs to the Msh homeobox family.
Acts as a transcriptional regulator in bone development. Represses the ALPL promoter activity and antagonizes the stimulatory effect of DLX5 on ALPL expression during osteoblast differentiation. Probable morphogenetic role. May play a role in limb-pattern formation. In osteoblasts, suppresses transcription driven by the osteocalcin FGF response element (OCFRE). Binds to the homeodomain-response element of the ALPL promoter.
Nucleus.
Interacts with MINT (By similarity). Interacts with XRCC6 (Ku70) and XRCC5 (Ku80).
Belongs to the Msh homeobox family.
Research Fields
· Human Diseases > Infectious diseases: Viral > HTLV-I infection.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.