TP53INP1 Antibody - #DF8731
Product: | TP53INP1 Antibody |
Catalog: | DF8731 |
Description: | Rabbit polyclonal antibody to TP53INP1 |
Application: | WB IHC IF/ICC |
Reactivity: | Human, Mouse |
Prediction: | Pig, Bovine, Horse, Sheep, Rabbit, Dog |
Mol.Wt.: | 27 kDa; 27kD(Calculated). |
Uniprot: | Q96A56 |
RRID: | AB_2841935 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF8731, RRID:AB_2841935.
Fold/Unfold
DKFZp434M1317; FLJ22139; p53 damage inducible nuclear protein 1; p53 dependent damage inducible nuclear protein 1; p53 inducible nuclear protein 1; p53 inducible p53DINP1; p53-dependent damage-inducible nuclear protein 1; p53DINP1; SIP; Stress induced protein; Stress-induced protein; T53I1_HUMAN; Teap; TP53 DINP1; TP53 INP1; TP53DINP1; TP53INP1; TP53INP1A; TP53INP1B; Tumor protein p53 inducible nuclear protein 1; Tumor protein p53-inducible nuclear protein 1;
Immunogens
- Q96A56 T53I1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MFQRLNKMFVGEVSSSSNQEPEFNEKEDDEWILVDFIDTCTGFSAEEEEEEEDISEESPTEHPSVFSCLPASLECLADTSDSCFLQFESCPMEESWFITPPPCFTAGGLTTIKVETSPMENLLIEHPSMSVYAVHNSCPGLSEATRGTDELHSPSSPRVEAQNEMGQHIHCYVAALAAHTTFLEQPKSFRPSQWIKEHSERQPLNRNSLRRQNLTRDCHPRQVKHNGWVVHQPCPRQYNY
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q96A56 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
S153 | Phosphorylation | Uniprot | |
S156 | Phosphorylation | Uniprot |
Research Backgrounds
Antiproliferative and proapoptotic protein involved in cell stress response which acts as a dual regulator of transcription and autophagy. Acts as a positive regulator of autophagy. In response to cellular stress or activation of autophagy, relocates to autophagosomes where it interacts with autophagosome-associated proteins GABARAP, GABARAPL1/L2, MAP1LC3A/B/C and regulates autophagy. Acts as an antioxidant and plays a major role in p53/TP53-driven oxidative stress response. Possesses both a p53/TP53-independent intracellular reactive oxygen species (ROS) regulatory function and a p53/TP53-dependent transcription regulatory function. Positively regulates p53/TP53 and p73/TP73 and stimulates their capacity to induce apoptosis and regulate cell cycle. In response to double-strand DNA breaks, promotes p53/TP53 phosphorylation on 'Ser-46' and subsequent apoptosis. Acts as a tumor suppressor by inducing cell death by an autophagy and caspase-dependent mechanism. Can reduce cell migration by regulating the expression of SPARC.
Cytoplasm>Cytosol. Nucleus. Nucleus>PML body. Cytoplasmic vesicle>Autophagosome.
Note: Shuttles between the nucleus and the cytoplasm, depending on cellular stress conditions, and re-localizes to autophagosomes on autophagy activation.
Ubiquitously expressed.
Interacts with p53/TP53 and HIPK2. Interacts with PRKCG, GABARAP, GABARAPL1, GABARAPL2, MAP1LC3A, MAP1LC3B AND MAP1LC3C.
The LC3 interacting region (LIR) motif mediates interaction with GABARAP, GABARAPL1, GABARAPL2, MAP1LC3A, MAP1LC3B and MAP1LC3C.
Research Fields
· Human Diseases > Infectious diseases: Viral > HTLV-I infection.
References
Application: WB Species: Human Sample: granulosa cells
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.