OR2A5/2A14 Antibody - #DF8691
Product: | OR2A5/2A14 Antibody |
Catalog: | DF8691 |
Description: | Rabbit polyclonal antibody to OR2A5/2A14 |
Application: | WB IF/ICC |
Reactivity: | Human, Mouse, Rat |
Prediction: | Bovine, Rabbit, Dog |
Mol.Wt.: | 35 kDa; 35kD(Calculated). |
Uniprot: | Q96R47 | Q96R48 |
RRID: | AB_2841895 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF8691, RRID:AB_2841895.
Fold/Unfold
Olfactory receptor 2A14; Olfactory receptor 2A26; Olfactory receptor 2A5; Olfactory receptor 2A6; Olfactory receptor 2A8; Olfactory receptor 7 138/7 141; Olfactory receptor OR7 12; Olfactory receptor, family 2, subfamily A, member 11 pseudogene; Olfactory receptor, family 2, subfamily A, member 14; Olfactory receptor, family 2, subfamily A, member 14 pseudogene; Olfactory receptor, family 2, subfamily A, member 26; Olfactory receptor, family 2, subfamily A, member 5; Olfactory receptor, family 2, subfamily A, member 6; Olfactory receptor, family 2, subfamily A, member 8; OR2A11P; OR2A14P; OR2A26; OR2A6; OR2A8; OR7 138; OR7 141; OST182; Olfactory receptor 2A14; Olfactory receptor 2A26; Olfactory receptor 2A5; Olfactory receptor 2A6; Olfactory receptor 2A8; Olfactory receptor 7 138/7 141; Olfactory receptor OR7 12; Olfactory receptor, family 2, subfamily A, member 11 pseudogene; Olfactory receptor, family 2, subfamily A, member 14; Olfactory receptor, family 2, subfamily A, member 14 pseudogene; Olfactory receptor, family 2, subfamily A, member 26; Olfactory receptor, family 2, subfamily A, member 5; Olfactory receptor, family 2, subfamily A, member 6; Olfactory receptor, family 2, subfamily A, member 8; OR2A11P; OR2A14P; OR2A26; OR2A6; OR2A8; OR7 138; OR7 141; OST182;
Immunogens
- Q96R47 O2A14_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MEGNKTWITDITLPRFQVGPALEILLCGLFSAFYTLTLLGNGVIFGIICLDCKLHTPMYFFLSHLAIVDISYASNYVPKMLTNLMNQESTISFFPCIMQTFLYLAFAHVECLILVVMSYDRYADICHPLRYNSLMSWRVCTVLAVASWVFSFLLALVPLVLILSLPFCGPHEINHFFCEILSVLKLACADTWLNQVVIFAACVFILVGPLCLVLVSYLRILAAILRIQSGEGRRKAFSTCSSHLCVVGLFFGSAIVTYMAPKSRHPEEQQKVLSLFYSLFNPMLNPLIYSLRNAEVKGALRRALRKERLT
- Q96R48 OR2A5_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MTKNQTWVTEFILLGFPLSLRIQMLLSGLFSLLYVFTLLGNGAILGLIWLDSRLHTPMYFFLSHLAIIDISYASNNVPKMLTNLGLNKRKTISFVPCTMQTFLYMAFAHTECLILVMMSYDRYMAICHPLQYSVIMRWGVCTVLAVTSWACGSLLALVHVVLILRLPFCGPHEINHFFCEILSVLKLACADTWLNQVVIFAASVFILVGPLCLVLVSYSRILAAILRIQSGEGRRKAFSTCSSHLCMVGLFFGSAIVMYMAPKSRHPEEQQKVLSLFYSLFNPMLNPLIYSLRNAEVKGALKRVLWKQRSK
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q96R47/Q96R48 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
Y76 | Phosphorylation | Uniprot |
Site | PTM Type | Enzyme | Source |
---|---|---|---|
S52 | Phosphorylation | Uniprot |
Research Backgrounds
Odorant receptor.
Cell membrane>Multi-pass membrane protein.
Belongs to the G-protein coupled receptor 1 family.
Odorant receptor.
Cell membrane>Multi-pass membrane protein.
Belongs to the G-protein coupled receptor 1 family.
Research Fields
· Organismal Systems > Sensory system > Olfactory transduction.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.