RAMP1 Antibody - #DF8597
Product: | RAMP1 Antibody |
Catalog: | DF8597 |
Description: | Rabbit polyclonal antibody to RAMP1 |
Application: | WB |
Reactivity: | Human, Mouse, Rat |
Prediction: | Dog |
Mol.Wt.: | 16 kDa; 17kD(Calculated). |
Uniprot: | O60894 |
RRID: | AB_2841801 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF8597, RRID:AB_2841801.
Fold/Unfold
Calcitonin receptor like receptor activity modifying protein 1; Calcitonin-receptor-like receptor activity-modifying protein 1; CRLR activity modifying protein 1; CRLR activity-modifying protein 1; Ramp1; RAMP1_HUMAN; receptor (calcitonin) activity modifying protein 1; Receptor (G protein coupled) activity modifying protein 1; Receptor activity modifying protein 1 [Precursor]; Receptor activity-modifying protein 1;
Immunogens
Expressed in many tissues including the uterus, bladder, brain, pancreas and gastro-intestinal tract.
- O60894 RAMP1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MARALCRLPRRGLWLLLAHHLFMTTACQEANYGALLRELCLTQFQVDMEAVGETLWCDWGRTIRSYRELADCTWHMAEKLGCFWPNAEVDRFFLAVHGRYFRSCPISGRAVRDPPGSILYPFIVVPITVTLLVTALVVWQSKRTEGIV
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - O60894 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
Y100 | Phosphorylation | Uniprot | |
S103 | Phosphorylation | Uniprot | |
S107 | Phosphorylation | Uniprot |
Research Backgrounds
Transports the calcitonin gene-related peptide type 1 receptor (CALCRL) to the plasma membrane. Acts as a receptor for calcitonin-gene-related peptide (CGRP) together with CALCRL.
Membrane>Single-pass type I membrane protein.
Expressed in many tissues including the uterus, bladder, brain, pancreas and gastro-intestinal tract.
Heterodimer of CALCRL and RAMP1.
Belongs to the RAMP family.
Research Fields
· Organismal Systems > Circulatory system > Vascular smooth muscle contraction. (View pathway)
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.