HES2 Antibody - #DF8555
| Product: | HES2 Antibody |
| Catalog: | DF8555 |
| Description: | Rabbit polyclonal antibody to HES2 |
| Application: | WB |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Rabbit |
| Mol.Wt.: | 18 kDa; 18kD(Calculated). |
| Uniprot: | Q9Y543 |
| RRID: | AB_2841759 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF8555, RRID:AB_2841759.
Fold/Unfold
;antibody;bHLHb40; Class B basic helix loop helix protein 40; Class B basic helix-loop-helix protein 40; Hairy and enhancer of split 2 (Drosophila); Hairy and enhancer of split 2; Hes2; HES2_HUMAN; Transcription factor HES 2; Transcription factor HES-2;
Immunogens
Expressed in placenta, pancreatic cancer, colon cancer with RER, cervical cancer, and in head and neck tumors.
- Q9Y543 HES2_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MGLPRRAGDAAELRKSLKPLLEKRRRARINQSLSQLKGLILPLLGRENSNCSKLEKADVLEMTVRFLQELPASSWPTAAPLPCDSYREGYSACVARLARVLPACRVLEPAVSARLLEHLWRRAASATLDGGRAGDSSGPSAPAPAPASAPEPASAPVPSPPSPPCGPGLWRPW
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
Transcriptional repressor of genes that require a bHLH protein for their transcription.
Nucleus.
Expressed in placenta, pancreatic cancer, colon cancer with RER, cervical cancer, and in head and neck tumors.
Transcription repression requires formation of a complex with a corepressor protein of the Groucho/TLE family.
Has a particular type of basic domain (presence of a helix-interrupting proline) that binds to the N-box (CACNAG), rather than the canonical E-box (CANNTG).
The C-terminal WRPW motif is a transcriptional repression domain necessary for the interaction with Groucho/TLE family members, transcriptional corepressors recruited to specific target DNA by Hairy-related proteins.
Research Fields
· Human Diseases > Infectious diseases: Viral > Human papillomavirus infection.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.