GNRHR Antibody - #DF8428
Product: | GNRHR Antibody |
Catalog: | DF8428 |
Description: | Rabbit polyclonal antibody to GNRHR |
Application: | WB IHC |
Reactivity: | Human |
Prediction: | Rat, Pig, Bovine, Horse, Sheep, Rabbit, Dog |
Mol.Wt.: | 38 kDa.; 38kD(Calculated). |
Uniprot: | P30968 |
RRID: | AB_2841676 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF8428, RRID:AB_2841676.
Fold/Unfold
GnRH receptor; GnRH-R; GNRHR; GNRHR_HUMAN; GNRHR1; Gonadotropin releasing hormone receptor; gonadotropin-releasing hormone (type 1) receptor 1; Gonadotropin-releasing hormone receptor; GRHR; HH7; leutinizing-releasing hormone receptor; lh-rh; LHRHR; LRHR; luliberin receptor; luteinizing hormone releasing hormone receptor; type I GnRH receptor;
Immunogens
- P30968 GNRHR_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MANSASPEQNQNHCSAINNSIPLMQGNLPTLTLSGKIRVTVTFFLFLLSATFNASFLLKLQKWTQKKEKGKKLSRMKLLLKHLTLANLLETLIVMPLDGMWNITVQWYAGELLCKVLSYLKLFSMYAPAFMMVVISLDRSLAITRPLALKSNSKVGQSMVGLAWILSSVFAGPQLYIFRMIHLADSSGQTKVFSQCVTHCSFSQWWHQAFYNFFTFSCLFIIPLFIMLICNAKIIFTLTRVLHQDPHELQLNQSKNNIPRARLKTLKMTVAFATSFTVCWTPYYVLGIWYWFDPEMLNRLSDPVNHFFFLFAFLNPCFDPLIYGYFSL
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
Research Backgrounds
Receptor for gonadotropin releasing hormone (GnRH) that mediates the action of GnRH to stimulate the secretion of the gonadotropic hormones luteinizing hormone (LH) and follicle-stimulating hormone (FSH). This receptor mediates its action by association with G-proteins that activate a phosphatidylinositol-calcium second messenger system. Isoform 2 may act as an inhibitor of GnRH-R signaling.
Cell membrane>Multi-pass membrane protein.
Pituitary, ovary, testis, breast and prostate but not in liver and spleen.
Belongs to the G-protein coupled receptor 1 family.
Research Fields
· Environmental Information Processing > Signaling molecules and interaction > Neuroactive ligand-receptor interaction.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.