DUSP3 Antibody - #DF8238
Product: | DUSP3 Antibody |
Catalog: | DF8238 |
Description: | Rabbit polyclonal antibody to DUSP3 |
Application: | WB IHC |
Reactivity: | Human, Mouse |
Prediction: | Pig, Bovine, Dog, Chicken |
Mol.Wt.: | 20 kDa; 20kD(Calculated). |
Uniprot: | P51452 |
RRID: | AB_2841534 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF8238, RRID:AB_2841534.
Fold/Unfold
Dual specificity phosphatase 3; Dual specificity protein phosphatase 3; Dual specificity protein phosphatase VHR; DUS3_HUMAN; DUSP3; Serine/threonine specific protein phosphatase; Vaccinia H1-related phosphatase; Vaccinia virus phosphatase VH1 related; VHR;
Immunogens
- P51452 DUS3_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MSGSFELSVQDLNDLLSDGSGCYSLPSQPCNEVTPRIYVGNASVAQDIPKLQKLGITHVLNAAEGRSFMHVNTNANFYKDSGITYLGIKANDTQEFNLSAYFERAADFIDQALAQKNGRVLVHCREGYSRSPTLVIAYLMMRQKMDVKSALSIVRQNREIGPNDGFLAQLCQLNDRLAKEGKLKP
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - P51452 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
S8 | Phosphorylation | Uniprot | |
Y38 | Phosphorylation | P43403 (ZAP70) , P43405 (SYK) | Uniprot |
K50 | Acetylation | Uniprot | |
K50 | Ubiquitination | Uniprot | |
K53 | Ubiquitination | Uniprot | |
S67 | Phosphorylation | Uniprot | |
S81 | Phosphorylation | Uniprot | |
T93 | Phosphorylation | Uniprot | |
Y101 | Phosphorylation | Uniprot | |
K116 | Ubiquitination | Uniprot | |
Y138 | Phosphorylation | P43403 (ZAP70) , P43405 (SYK) , P29597 (TYK2) | Uniprot |
S149 | Phosphorylation | Uniprot |
Research Backgrounds
Shows activity both for tyrosine-protein phosphate and serine-protein phosphate, but displays a strong preference toward phosphotyrosines. Specifically dephosphorylates and inactivates ERK1 and ERK2.
Nucleus.
Interacts with VRK3, which seems to activate it's phosphatase activity.
Belongs to the protein-tyrosine phosphatase family. Non-receptor class dual specificity subfamily.
Research Fields
· Environmental Information Processing > Signal transduction > MAPK signaling pathway. (View pathway)
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.