CD72 Antibody - #DF7910
Product: | CD72 Antibody |
Catalog: | DF7910 |
Description: | Rabbit polyclonal antibody to CD72 |
Application: | WB IHC |
Reactivity: | Human, Mouse |
Mol.Wt.: | 40 kDa; 40kD(Calculated). |
Uniprot: | P21854 |
RRID: | AB_2841327 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF7910, RRID:AB_2841327.
Fold/Unfold
B cell differentiation antigen CD72; B-cell differentiation antigen CD72; CD_antigen=CD72; CD72; CD72 antigen; CD72 molecule; CD72_HUMAN; CD72b; CD72c; Ly-19; Ly-32; Ly-m19; Lyb-2; Lyb2; LYB2, mouse, homolog of; Lymphocyte antigen 32; MGC108873;
Immunogens
- P21854 CD72_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MAEAITYADLRFVKAPLKKSISSRLGQDPGADDDGEITYENVQVPAVLGVPSSLASSVLGDKAAVKSEQPTASWRAVTSPAVGRILPCRTTCLRYLLLGLLLTCLLLGVTAICLGVRYLQVSQQLQQTNRVLEVTNSSLRQQLRLKITQLGQSAEDLQGSRRELAQSQEALQVEQRAHQAAEGQLQACQADRQKTKETLQSEEQQRRALEQKLSNMENRLKPFFTCGSADTCCPSGWIMHQKSCFYISLTSKNWQESQKQCETLSSKLATFSEIYPQSHSYYFLNSLLPNGGSGNSYWTGLSSNKDWKLTDDTQRTRTYAQSSKCNKVHKTWSWWTLESESCRSSLPYICEMTAFRFPD
PTMs - P21854 As Substrate
Research Backgrounds
Plays a role in B-cell proliferation and differentiation.
Phosphorylated upon engagement of the B-cell receptor, probably by LYN or SYK. Phosphorylation at Tyr-7 is important for interaction with PTPN6/SHP-1 (By similarity).
Membrane>Single-pass type II membrane protein.
Pre-B-cells and B-cells but not terminally differentiated plasma cells.
Homodimer; disulfide-linked. Associates with CD5. Interacts (tyrosine phosphorylated) with PTPN6/SHP-1 (By similarity).
Research Fields
· Organismal Systems > Immune system > B cell receptor signaling pathway. (View pathway)
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.