LAMTOR3 Antibody - #DF7638
Product: | LAMTOR3 Antibody |
Catalog: | DF7638 |
Description: | Rabbit polyclonal antibody to LAMTOR3 |
Application: | WB |
Reactivity: | Human, Mouse, Rat |
Prediction: | Pig, Zebrafish, Bovine, Horse, Sheep, Rabbit, Dog, Chicken, Xenopus |
Mol.Wt.: | 14 kDa; 14kD(Calculated). |
Uniprot: | Q9UHA4 |
RRID: | AB_2841119 |
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF7638, RRID:AB_2841119.
Fold/Unfold
LAMTOR3; Late endosomal/lysosomal adaptor and MAPK and MTOR activator 3; LTOR3_HUMAN; MAP2K1IP1; MEK binding partner 1; MEK partner 1; MEK-binding partner 1; Mitogen activated protein kinase kinase 1 interacting protein 1; Mitogen-activated protein kinase kinase 1-interacting protein 1; Mitogen-activated protein kinase scaffold protein 1; Mp1; Ragulator complex protein LAMTOR3;
Immunogens
- Q9UHA4 LTOR3_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MADDLKRFLYKKLPSVEGLHAIVVSDRDGVPVIKVANDNAPEHALRPGFLSTFALATDQGSKLGLSKNKSIICYYNTYQVVQFNRLPLVVSFIASSSANTGLIVSLEKELAPLFEELRQVVEVS
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q9UHA4 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
K62 | Ubiquitination | Uniprot |
Research Backgrounds
As part of the Ragulator complex it is involved in amino acid sensing and activation of mTORC1, a signaling complex promoting cell growth in response to growth factors, energy levels, and amino acids. Activated by amino acids through a mechanism involving the lysosomal V-ATPase, the Ragulator functions as a guanine nucleotide exchange factor activating the small GTPases Rag. Activated Ragulator and Rag GTPases function as a scaffold recruiting mTORC1 to lysosomes where it is in turn activated. Adapter protein that enhances the efficiency of the MAP kinase cascade facilitating the activation of MAPK2.
Late endosome membrane>Peripheral membrane protein>Cytoplasmic side.
Part of the Ragulator complex composed of LAMTOR1, LAMTOR2, LAMTOR3, LAMTOR4 and LAMTOR5. LAMTOR4 and LAMTOR5 form a heterodimer that interacts, through LAMTOR1, with a LAMTOR2, LAMTOR3 heterodimer. The Ragulator complex interacts with both the mTORC1 complex and heterodimers constituted of the Rag GTPases RRAGA, RRAGB, RRAGC and RRAGD; regulated by amino acid availability. The Ragulator complex interacts with SLC38A9; the probable amino acid sensor. Interacts with LAMTOR1 and LAMTOR2; the interaction is direct. Interacts with MAP2K1/MEK1 and MAPK2 (By similarity). Interacts with MORG1 (By similarity).
Belongs to the LAMTOR3 family.
Research Fields
· Environmental Information Processing > Signal transduction > MAPK signaling pathway. (View pathway)
· Environmental Information Processing > Signal transduction > mTOR signaling pathway. (View pathway)
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.