ASIP Antibody - #DF7612
Product: | ASIP Antibody |
Catalog: | DF7612 |
Description: | Rabbit polyclonal antibody to ASIP |
Application: | WB |
Reactivity: | Human |
Prediction: | Bovine, Horse, Sheep, Dog |
Mol.Wt.: | 14 kDa; 15kD(Calculated). |
Uniprot: | P42127 |
RRID: | AB_2841101 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF7612, RRID:AB_2841101.
Fold/Unfold
agouti signaling protein; Agouti switch protein; AGSW; AGTI; AGTIL; ASIP; ASP; SHEP9;
Immunogens
Expressed in adipose tissue, testis, ovary and heart and at lower levels in liver, kidney and foreskin.
- P42127 ASIP_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MDVTRLLLATLLVFLCFFTANSHLPPEEKLRDDRSLRSNSSVNLLDVPSVSIVALNKKSKQIGRKAAEKKRSSKKEASMKKVVRPRTPLSAPCVATRNSCKPPAPACCDPCASCQCRFFRSACSCRVLSLNC
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - P42127 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
S35 | Phosphorylation | Uniprot | |
T87 | Phosphorylation | Uniprot | |
S90 | Phosphorylation | Uniprot | |
T96 | Phosphorylation | Uniprot |
Research Backgrounds
Involved in the regulation of melanogenesis. The binding of ASP to MC1R precludes alpha-MSH initiated signaling and thus blocks production of cAMP, leading to a down-regulation of eumelanogenesis (brown/black pigment) and thus increasing synthesis of pheomelanin (yellow/red pigment). In higher primates, agouti may affect the quality of hair pigmentation rather than its pattern of deposition. Could well play a role in neuroendocrine aspects of melanocortin action. May have some functional role in regulating the lipid metabolism with adipocytes.
Secreted.
Expressed in adipose tissue, testis, ovary and heart and at lower levels in liver, kidney and foreskin.
The presence of a 'disulfide through disulfide knot' structurally defines this protein as a knottin.
Research Fields
· Organismal Systems > Endocrine system > Melanogenesis.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.