Otx1 Antibody - #DF2941
Product: | Otx1 Antibody |
Catalog: | DF2941 |
Description: | Rabbit polyclonal antibody to Otx1 |
Application: | WB IF/ICC |
Reactivity: | Human, Mouse, Rat |
Prediction: | Pig, Zebrafish, Bovine, Horse, Sheep, Rabbit, Dog, Chicken, Xenopus |
Mol.Wt.: | 37kDa; 37kD(Calculated). |
Uniprot: | P32242 |
RRID: | AB_2840925 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF2941, RRID:AB_2840925.
Fold/Unfold
FLJ38361; Homeobox protein OTX 1; Homeobox protein OTX1; Homeobox protein OTX2; MCOPS 5; MCOPS5; MGC15736; MGC45000; Orthodenticle 1; Orthodenticle 2; Orthodenticle homeobox 1; Orthodenticle homeobox 2; Orthodenticle homolog 1; Orthodenticle homolog 2 (Drosophila); Orthodenticle homolog 2; Orthodenticle1; Orthodenticle2; Otx 1; Otx 2; otx1; OTX1_HUMAN; otx2; OTX2_HUMAN;
Immunogens
Expressed in brain. Detected in the anterior part of the neural fetal retina (at protein level).
- P32242 OTX1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MMSYLKQPPYGMNGLGLAGPAMDLLHPSVGYPATPRKQRRERTTFTRSQLDVLEALFAKTRYPDIFMREEVALKINLPESRVQVWFKNRRAKCRQQQQSGSGTKSRPAKKKSSPVRESSGSESSGQFTPPAVSSSASSSSSASSSSANPAAAAAAGLGGNPVAAASSLSTPAASSIWSPASISPGSAPASVSVPEPLAAPSNTSCMQRSVAAGAATAAASYPMSYGQGGSYGQGYPTPSSSYFGGVDCSSYLAPMHSHHHPHQLSPMAPSSMAGHHHHHPHAHHPLSQSSGHHHHHHHHHHQGYGGSGLAFNSADCLDYKEPGAAAASSAWKLNFNSPDCLDYKDQASWRFQVL
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - P32242 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
T34 | Phosphorylation | Uniprot | |
S337 | Phosphorylation | Uniprot |
Research Backgrounds
Probably plays a role in the development of the brain and the sense organs. Can bind to the BCD target sequence (BTS): 5'-TCTAATCCC-3'.
Nucleus.
Expressed in brain. Detected in the anterior part of the neural fetal retina (at protein level).
Belongs to the paired homeobox family. Bicoid subfamily.
Research Fields
· Cellular Processes > Cellular community - eukaryotes > Signaling pathways regulating pluripotency of stem cells. (View pathway)
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.