TAAR6 Antibody - #DF10276
Product: | TAAR6 Antibody |
Catalog: | DF10276 |
Description: | Rabbit polyclonal antibody to TAAR6 |
Application: | WB |
Reactivity: | Human, Mouse, Rat |
Mol.Wt.: | 38 kDa; 38kD(Calculated). |
Uniprot: | Q96RI8 |
RRID: | AB_2840854 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF10276, RRID:AB_2840854.
Fold/Unfold
SCZD5; Ta4; Taar6; TAAR6_HUMAN; TaR 4; TaR-4; TaR-6; TaR4; Trace amine associated receptor 6; Trace amine receptor 4; Trace amine receptor 6; Trace amine-associated receptor 6; TRAR4;
Immunogens
Expressed at low abundance in various brain tissues, as well as in fetal liver, but not in the cerebellum or placenta. In the brain, comparable levels of expression in basal ganglia, frontal cortex, substantia nigra, amygdala and hippocampus, highest expression in hippocampus and lowest expression in basal ganglia.
- Q96RI8 TAAR6_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MSSNSSLLVAVQLCYANVNGSCVKIPFSPGSRVILYIVFGFGAVLAVFGNLLVMISILHFKQLHSPTNFLVASLACADFLVGVTVMPFSMVRTVESCWYFGRSFCTFHTCCDVAFCYSSLFHLCFISIDRYIAVTDPLVYPTKFTVSVSGICISVSWILPLMYSGAVFYTGVYDDGLEELSDALNCIGGCQTVVNQNWVLTDFLSFFIPTFIMIILYGNIFLVARRQAKKIENTGSKTESSSESYKARVARRERKAAKTLGVTVVAFMISWLPYSIDSLIDAFMGFITPACIYEICCWCAYYNSAMNPLIYALFYPWFRKAIKVIVTGQVLKNSSATMNLFSEHI
PTMs - Q96RI8 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
Y131 | Phosphorylation | Uniprot | |
Y140 | Phosphorylation | Uniprot | |
T238 | Phosphorylation | Uniprot | |
S241 | Phosphorylation | Uniprot | |
S244 | Phosphorylation | Uniprot | |
Y245 | Phosphorylation | Uniprot |
Research Backgrounds
Orphan receptor. Could be a receptor for trace amines. Trace amines are biogenic amines present in very low levels in mammalian tissues. Although some trace amines have clearly defined roles as neurotransmitters in invertebrates, the extent to which they function as true neurotransmitters in vertebrates has remained speculative. Trace amines are likely to be involved in a variety of physiological functions that have yet to be fully understood.
Cell membrane>Multi-pass membrane protein.
Expressed at low abundance in various brain tissues, as well as in fetal liver, but not in the cerebellum or placenta. In the brain, comparable levels of expression in basal ganglia, frontal cortex, substantia nigra, amygdala and hippocampus, highest expression in hippocampus and lowest expression in basal ganglia.
Belongs to the G-protein coupled receptor 1 family.
Research Fields
· Environmental Information Processing > Signaling molecules and interaction > Neuroactive ligand-receptor interaction.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.