LT4R1 Antibody - #DF10223
Product: | LT4R1 Antibody |
Catalog: | DF10223 |
Description: | Rabbit polyclonal antibody to LT4R1 |
Application: | WB IHC |
Reactivity: | Human, Mouse, Rat, Monkey |
Prediction: | Horse, Rabbit, Dog |
Mol.Wt.: | 38 kDa; 38kD(Calculated). |
Uniprot: | Q15722 |
RRID: | AB_2840801 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF10223, RRID:AB_2840801.
Fold/Unfold
BLT; BLT1; BLTR; Chemoattractant receptor-like 1; Chemokine receptor like 1; CMKRL1; G protein coupled receptor 16; G-protein coupled receptor 16; GPR16; Leukotriene B4 G Protein coupled receptor; Leukotriene B4 receptor 1; Leukotriene B4 receptor; LT4R1_HUMAN; LTB4 R 1; LTB4-R 1; LTB4-R1; LTB4R 1; Ltb4r; LTB4R1; LTBR1; P2RY7; P2Y purinoceptor 7; P2Y7; Purinergic receptor P2Y G protein coupled 7;
Immunogens
Expressed at highest levels in heart, skeletal muscle and at lower levels in brain and liver. High level of expression in lymphoid tissues.
- Q15722 LT4R1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MNTTSSAAPPSLGVEFISLLAIILLSVALAVGLPGNSFVVWSILKRMQKRSVTALMVLNLALADLAVLLTAPFFLHFLAQGTWSFGLAGCRLCHYVCGVSMYASVLLITAMSLDRSLAVARPFVSQKLRTKAMARRVLAGIWVLSFLLATPVLAYRTVVPWKTNMSLCFPRYPSEGHRAFHLIFEAVTGFLLPFLAVVASYSDIGRRLQARRFRRSRRTGRLVVLIILTFAAFWLPYHVVNLAEAGRALAGQAAGLGLVGKRLSLARNVLIALAFLSSSVNPVLYACAGGGLLRSAGVGFVAKLLEGTGSEASSTRRGGSLGQTARSGPAALEPGPSESLTASSPLKLNELN
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q15722 As Substrate
Research Backgrounds
Receptor for extracellular ATP > UTP and ADP. The activity of this receptor is mediated by G proteins which activate a phosphatidylinositol-calcium second messenger system. May be the cardiac P2Y receptor involved in the regulation of cardiac muscle contraction through modulation of L-type calcium currents. Is a receptor for leukotriene B4, a potent chemoattractant involved in inflammation and immune response.
Phosphorylated by GRK6 upon leukotriene B4 binding; which promotes desensitization.
Cell membrane>Multi-pass membrane protein.
Expressed at highest levels in heart, skeletal muscle and at lower levels in brain and liver. High level of expression in lymphoid tissues.
Belongs to the G-protein coupled receptor 1 family.
Research Fields
· Environmental Information Processing > Signaling molecules and interaction > Neuroactive ligand-receptor interaction.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.